BLASTX nr result
ID: Rauwolfia21_contig00055521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00055521 (252 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI17229.1| hypothetical protein [uncultured alpha proteobact... 76 4e-12 ref|YP_001949470.1| hypothetical protein BMULJ_05092 [Burkholder... 55 7e-06 >gb|ADI17229.1| hypothetical protein [uncultured alpha proteobacterium HF0070_14E07] Length = 139 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/44 (81%), Positives = 37/44 (84%) Frame = +2 Query: 50 GLSPVTSSAQKPLFRPVSCYAFFKGWLLLSQPPGCFGISTSFPT 181 GLSP TSSAQ L RPVS YAFFKGWLLLSQPPGC G+ TSFPT Sbjct: 96 GLSPDTSSAQAGLSRPVSYYAFFKGWLLLSQPPGCLGLPTSFPT 139 >ref|YP_001949470.1| hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 17616] gi|501444602|ref|WP_012468051.1| hypothetical protein [Burkholderia multivorans] gi|189337865|dbj|BAG46934.1| hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 17616] Length = 123 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 92 RPVSCYAFFKGWLLLSQPPGCFGISTSFPT 181 R VS YAFFKGWLLLSQPP CF + TSFPT Sbjct: 94 RSVSYYAFFKGWLLLSQPPDCFSLPTSFPT 123