BLASTX nr result
ID: Rauwolfia21_contig00055260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00055260 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 72 1e-10 gb|EXC08244.1| hypothetical protein L484_012700 [Morus notabilis] 65 7e-09 gb|EXC21503.1| hypothetical protein L484_014858 [Morus notabilis] 64 2e-08 gb|EXB24696.1| hypothetical protein L484_005490 [Morus notabilis] 61 2e-07 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/45 (80%), Positives = 36/45 (80%) Frame = +3 Query: 84 QACTPYLRLLRHAVDSFIREGKKGPKHGRCRTLEWQRKKRDLTFF 218 QACT LRLLR AVDSFIREGKKGPKH RCRTLEWQRK FF Sbjct: 112 QACT--LRLLRQAVDSFIREGKKGPKHLRCRTLEWQRKAGSYLFF 154 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 191 KEKARPYLFFQACSDIRFLRKIKLVSRVMGNLPARFGEH 307 + KA YLFFQACSDIRF RKIKLVSRVMGNLPARFGEH Sbjct: 145 QRKAGSYLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 183 >gb|EXC08244.1| hypothetical protein L484_012700 [Morus notabilis] Length = 255 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 209 YLFFQACSDIRFLRKIKLVSRVMGNLPARFGEH 307 YLFFQACSDIRF RKIKLVSR MGNLPARFGEH Sbjct: 223 YLFFQACSDIRFPRKIKLVSRGMGNLPARFGEH 255 >gb|EXC21503.1| hypothetical protein L484_014858 [Morus notabilis] Length = 116 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +2 Query: 191 KEKARPYLFFQACSDIRFLRKIKLVSRVMGNLPARFGEH 307 + K R YLFFQACSDI F KIKLVSRVMGNLPA+FGEH Sbjct: 78 QRKTRSYLFFQACSDIWFPWKIKLVSRVMGNLPAQFGEH 116 >gb|EXB24696.1| hypothetical protein L484_005490 [Morus notabilis] Length = 1260 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/67 (52%), Positives = 37/67 (55%), Gaps = 9/67 (13%) Frame = +1 Query: 139 GKGRRGLSTADAVHLSGKGK---------SETLPFFPGLFGHTVPAEDQVGEPCDGKPSR 291 G GR + D G G+ T F GLFGHTVP EDQVGE CDGKPS Sbjct: 289 GSGRISAAGGDGFAGGGGGRVSINVFSRHDNTQFFVHGLFGHTVPVEDQVGELCDGKPSC 348 Query: 292 TVRRALN 312 TVRRALN Sbjct: 349 TVRRALN 355