BLASTX nr result
ID: Rauwolfia21_contig00054140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00054140 (253 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237696.1| PREDICTED: uncharacterized protein LOC101247... 55 1e-05 gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum ... 55 1e-05 >ref|XP_004237696.1| PREDICTED: uncharacterized protein LOC101247717 [Solanum lycopersicum] Length = 527 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +2 Query: 2 LAHNLLSTGQLL*K*YYVHFDAGRCVISDKK*NITIAKVKMTPNKAFPLQM 154 L+HNLLS G+L+ Y + FD G C I +KK TIA V MT NK FPLQ+ Sbjct: 79 LSHNLLSVGELMISGYSISFDDGVCTIKNKKSGKTIANVPMTNNKMFPLQV 129 >gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1333 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/69 (49%), Positives = 41/69 (59%) Frame = +2 Query: 2 LAHNLLSTGQLL*K*YYVHFDAGRCVISDKK*NITIAKVKMTPNKAFPLQMPMDKNFALK 181 LAHNLLS GQL+ Y V F C I DK+ TIA+V MT NK FPL + N AL Sbjct: 376 LAHNLLSVGQLMTSGYSVVFYDNACDIKDKESGRTIARVPMTQNKMFPLDISNVGNSALV 435 Query: 182 GEEINDSIL 208 +E N++ L Sbjct: 436 VKEKNETNL 444