BLASTX nr result
ID: Rauwolfia21_contig00054089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00054089 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA36535.1| TPA: hypothetical protein ZEAMMB73_278731, parti... 59 9e-07 ref|XP_002278371.1| PREDICTED: 40S ribosomal protein S7 isoform ... 58 1e-06 ref|XP_004241632.1| PREDICTED: 40S ribosomal protein S7-like iso... 58 1e-06 ref|XP_004241630.1| PREDICTED: 40S ribosomal protein S7-like iso... 58 1e-06 ref|XP_004235808.1| PREDICTED: 40S ribosomal protein S7-like [So... 58 1e-06 ref|NP_001275109.1| ribosomal protein S7-like protein [Solanum t... 58 1e-06 ref|XP_006353807.1| PREDICTED: 40S ribosomal protein S7-like [So... 56 4e-06 ref|XP_006853690.1| hypothetical protein AMTR_s00056p00135710 [A... 56 6e-06 tpg|DAA36537.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea m... 56 6e-06 tpg|DAA36536.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea m... 56 6e-06 pdb|3J60|H Chain H, Localization Of The Small Subunit Ribosomal ... 55 7e-06 ref|XP_006847231.1| hypothetical protein AMTR_s00017p00257730 [A... 55 7e-06 ref|XP_004984883.1| PREDICTED: 40S ribosomal protein S7-like [Se... 55 7e-06 gb|EMT15303.1| 40S ribosomal protein S7 [Aegilops tauschii] 55 7e-06 gb|AAW50993.1| ribosomal protein S7 [Triticum aestivum] gi|47415... 55 7e-06 tpg|DAA56091.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea m... 55 7e-06 tpg|DAA56090.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea m... 55 7e-06 ref|XP_003573860.1| PREDICTED: 40S ribosomal protein S7-like [Br... 55 7e-06 ref|XP_002459905.1| hypothetical protein SORBIDRAFT_02g014260 [S... 55 7e-06 ref|NP_001131888.1| 40S ribosomal protein S7 isoform 1 [Zea mays... 55 7e-06 >tpg|DAA36535.1| TPA: hypothetical protein ZEAMMB73_278731, partial [Zea mays] Length = 48 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFLLCS 241 PYRLRKAFRKIHVRLVRELEKKFSGKV + ++ + Sbjct: 15 PYRLRKAFRKIHVRLVRELEKKFSGKVYMLIVAT 48 >ref|XP_002278371.1| PREDICTED: 40S ribosomal protein S7 isoform 1 [Vitis vinifera] gi|147789484|emb|CAN71757.1| hypothetical protein VITISV_000603 [Vitis vinifera] gi|297734220|emb|CBI15467.3| unnamed protein product [Vitis vinifera] Length = 191 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRKAFRKIHVRLVRELEKKFSGK +F+ Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGKDVIFI 96 >ref|XP_004241632.1| PREDICTED: 40S ribosomal protein S7-like isoform 3 [Solanum lycopersicum] Length = 155 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRKAFRK+HVRLVRELEKKFSGK +F+ Sbjct: 66 PYRLRKAFRKVHVRLVRELEKKFSGKDVIFI 96 >ref|XP_004241630.1| PREDICTED: 40S ribosomal protein S7-like isoform 1 [Solanum lycopersicum] gi|460392051|ref|XP_004241631.1| PREDICTED: 40S ribosomal protein S7-like isoform 2 [Solanum lycopersicum] Length = 191 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRKAFRK+HVRLVRELEKKFSGK +F+ Sbjct: 66 PYRLRKAFRKVHVRLVRELEKKFSGKDVIFI 96 >ref|XP_004235808.1| PREDICTED: 40S ribosomal protein S7-like [Solanum lycopersicum] gi|565349218|ref|XP_006341594.1| PREDICTED: 40S ribosomal protein S7-like [Solanum tuberosum] Length = 191 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRKAFRK+HVRLVRELEKKFSGK +F+ Sbjct: 66 PYRLRKAFRKVHVRLVRELEKKFSGKDVIFI 96 >ref|NP_001275109.1| ribosomal protein S7-like protein [Solanum tuberosum] gi|565399723|ref|XP_006365396.1| PREDICTED: 40S ribosomal protein S7-1 isoform X2 [Solanum tuberosum] gi|565399725|ref|XP_006365397.1| PREDICTED: 40S ribosomal protein S7-1 isoform X3 [Solanum tuberosum] gi|76160947|gb|ABA40437.1| 40S ribosomal protein S7-like protein [Solanum tuberosum] gi|76573341|gb|ABA46775.1| unknown [Solanum tuberosum] gi|77999315|gb|ABB17004.1| ribosomal protein S7-like protein [Solanum tuberosum] gi|82623373|gb|ABB87101.1| 40S ribosomal protein S7-like protein-like [Solanum tuberosum] Length = 191 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRKAFRK+HVRLVRELEKKFSGK +F+ Sbjct: 66 PYRLRKAFRKVHVRLVRELEKKFSGKDVIFI 96 >ref|XP_006353807.1| PREDICTED: 40S ribosomal protein S7-like [Solanum tuberosum] Length = 190 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRKAFRKIHVRLVRELEKKFSGK + + Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGKYVIVI 96 >ref|XP_006853690.1| hypothetical protein AMTR_s00056p00135710 [Amborella trichopoda] gi|548857351|gb|ERN15157.1| hypothetical protein AMTR_s00056p00135710 [Amborella trichopoda] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRKAFRKIHVRLVRELEKKFSGK + + Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGKDVIMI 96 >tpg|DAA36537.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea mays] Length = 109 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKV 262 PYRLRKAFRKIHVRLVRELEKKFSGK+ Sbjct: 56 PYRLRKAFRKIHVRLVRELEKKFSGKL 82 >tpg|DAA36536.1| TPA: hypothetical protein ZEAMMB73_278731 [Zea mays] Length = 109 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKV 262 PYRLRKAFRKIHVRLVRELEKKFSGK+ Sbjct: 56 PYRLRKAFRKIHVRLVRELEKKFSGKL 82 >pdb|3J60|H Chain H, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome Length = 189 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRK FRKIHVRLVRELEKKFSGK +F+ Sbjct: 63 PYRLRKPFRKIHVRLVRELEKKFSGKDVVFV 93 >ref|XP_006847231.1| hypothetical protein AMTR_s00017p00257730 [Amborella trichopoda] gi|548850260|gb|ERN08812.1| hypothetical protein AMTR_s00017p00257730 [Amborella trichopoda] Length = 192 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGK 265 PYRLRKAFRKIHVRLVRELEKKFSGK Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|XP_004984883.1| PREDICTED: 40S ribosomal protein S7-like [Setaria italica] Length = 192 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGK 265 PYRLRKAFRKIHVRLVRELEKKFSGK Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGK 91 >gb|EMT15303.1| 40S ribosomal protein S7 [Aegilops tauschii] Length = 189 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRK FRKIHVRLVRELEKKFSGK +F+ Sbjct: 63 PYRLRKPFRKIHVRLVRELEKKFSGKDVVFV 93 >gb|AAW50993.1| ribosomal protein S7 [Triticum aestivum] gi|474150494|gb|EMS56913.1| 40S ribosomal protein S7 [Triticum urartu] Length = 192 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGKVTLFL 250 PYRLRK FRKIHVRLVRELEKKFSGK +F+ Sbjct: 66 PYRLRKPFRKIHVRLVRELEKKFSGKDVVFV 96 >tpg|DAA56091.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea mays] Length = 399 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGK 265 PYRLRKAFRKIHVRLVRELEKKFSGK Sbjct: 100 PYRLRKAFRKIHVRLVRELEKKFSGK 125 >tpg|DAA56090.1| TPA: hypothetical protein ZEAMMB73_002867 [Zea mays] Length = 513 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGK 265 PYRLRKAFRKIHVRLVRELEKKFSGK Sbjct: 100 PYRLRKAFRKIHVRLVRELEKKFSGK 125 >ref|XP_003573860.1| PREDICTED: 40S ribosomal protein S7-like [Brachypodium distachyon] Length = 192 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGK 265 PYRLRKAFRKIHVRLVRELEKKFSGK Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|XP_002459905.1| hypothetical protein SORBIDRAFT_02g014260 [Sorghum bicolor] gi|241923282|gb|EER96426.1| hypothetical protein SORBIDRAFT_02g014260 [Sorghum bicolor] Length = 92 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGK 265 PYRLRKAFRKIHVRLVRELEKKFSGK Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGK 91 >ref|NP_001131888.1| 40S ribosomal protein S7 isoform 1 [Zea mays] gi|195605060|gb|ACG24360.1| 40S ribosomal protein S7 [Zea mays] gi|195605668|gb|ACG24664.1| 40S ribosomal protein S7 [Zea mays] gi|414866347|tpg|DAA44904.1| TPA: 40S ribosomal protein S7 isoform 1 [Zea mays] gi|414866348|tpg|DAA44905.1| TPA: 40S ribosomal protein S7 isoform 2 [Zea mays] Length = 192 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 342 PYRLRKAFRKIHVRLVRELEKKFSGK 265 PYRLRKAFRKIHVRLVRELEKKFSGK Sbjct: 66 PYRLRKAFRKIHVRLVRELEKKFSGK 91