BLASTX nr result
ID: Rauwolfia21_contig00053774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00053774 (253 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498363.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_004306308.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_006338715.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 gb|EMJ16126.1| hypothetical protein PRUPE_ppa002717mg [Prunus pe... 58 1e-06 ref|XP_004233584.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 gb|EXC33394.1| hypothetical protein L484_010804 [Morus notabilis] 57 2e-06 dbj|BAB08287.1| unnamed protein product [Arabidopsis thaliana] 55 1e-05 gb|ESW33676.1| hypothetical protein PHAVU_001G089400g [Phaseolus... 55 1e-05 gb|ESW33675.1| hypothetical protein PHAVU_001G089400g [Phaseolus... 55 1e-05 gb|ESW33674.1| hypothetical protein PHAVU_001G089400g [Phaseolus... 55 1e-05 ref|XP_006399916.1| hypothetical protein EUTSA_v10012953mg [Eutr... 55 1e-05 ref|XP_006287262.1| hypothetical protein CARUB_v10000456mg [Caps... 55 1e-05 ref|NP_196912.2| pentatricopeptide repeat-containing protein [Ar... 55 1e-05 ref|XP_002873646.1| pentatricopeptide repeat-containing protein ... 55 1e-05 >ref|XP_004498363.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like isoform X1 [Cicer arietinum] Length = 640 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLLNH +ALGFFN ASQQPGF+HTS+T+ +ILKSL Sbjct: 61 IDPFLLNHHSLALGFFNWASQQPGFNHTSTTFHSILKSL 99 >ref|XP_004306308.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like [Fragaria vesca subsp. vesca] Length = 630 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLLNH +ALGFFN ASQQP FSHTS TY+++LKSL Sbjct: 56 IDPFLLNHHSLALGFFNWASQQPSFSHTSLTYQSVLKSL 94 >ref|XP_006338715.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like [Solanum tuberosum] Length = 650 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSLYI 62 ID FL++H +ALGFFN ASQQPGFSH SSTY +IL SL I Sbjct: 54 IDPFLVHHHSLALGFFNWASQQPGFSHDSSTYHSILNSLCI 94 >gb|EMJ16126.1| hypothetical protein PRUPE_ppa002717mg [Prunus persica] Length = 640 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLL H +ALGFFN ASQQP FSHTS TY+++LKSL Sbjct: 56 IDPFLLPHHSLALGFFNWASQQPSFSHTSITYKSVLKSL 94 >ref|XP_004233584.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like [Solanum lycopersicum] Length = 647 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FL++H +ALGFFN ASQQPGFSH SSTY +IL SL Sbjct: 53 IDPFLVHHHSLALGFFNWASQQPGFSHDSSTYHSILNSL 91 >gb|EXC33394.1| hypothetical protein L484_010804 [Morus notabilis] Length = 619 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLL H +ALGFFN ASQQPGFSH+S +Y++ILKSL Sbjct: 57 IDSFLLPHHSLALGFFNWASQQPGFSHSSISYQSILKSL 95 >dbj|BAB08287.1| unnamed protein product [Arabidopsis thaliana] Length = 663 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLLNH +ALGFFN A+QQPG+SH S +Y +I KSL Sbjct: 54 IDPFLLNHHSLALGFFNWAAQQPGYSHDSISYHSIFKSL 92 >gb|ESW33676.1| hypothetical protein PHAVU_001G089400g [Phaseolus vulgaris] Length = 666 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLL H +ALGFFN ASQQPGF HT TY ++LKSL Sbjct: 81 IDPFLLTHYSLALGFFNWASQQPGFVHTPFTYHSLLKSL 119 >gb|ESW33675.1| hypothetical protein PHAVU_001G089400g [Phaseolus vulgaris] Length = 581 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLL H +ALGFFN ASQQPGF HT TY ++LKSL Sbjct: 81 IDPFLLTHYSLALGFFNWASQQPGFVHTPFTYHSLLKSL 119 >gb|ESW33674.1| hypothetical protein PHAVU_001G089400g [Phaseolus vulgaris] Length = 671 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLL H +ALGFFN ASQQPGF HT TY ++LKSL Sbjct: 81 IDPFLLTHYSLALGFFNWASQQPGFVHTPFTYHSLLKSL 119 >ref|XP_006399916.1| hypothetical protein EUTSA_v10012953mg [Eutrema salsugineum] gi|557101006|gb|ESQ41369.1| hypothetical protein EUTSA_v10012953mg [Eutrema salsugineum] Length = 634 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLLNH +ALGFFN A+QQPG+SH S +Y +I KSL Sbjct: 54 IDPFLLNHHSLALGFFNWAAQQPGYSHDSLSYHSIFKSL 92 >ref|XP_006287262.1| hypothetical protein CARUB_v10000456mg [Capsella rubella] gi|482555968|gb|EOA20160.1| hypothetical protein CARUB_v10000456mg [Capsella rubella] Length = 633 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLLNH +ALGFFN A+QQPG+SH S +Y +I KSL Sbjct: 54 IDPFLLNHHSLALGFFNWAAQQPGYSHDSVSYHSIFKSL 92 >ref|NP_196912.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635762|sp|Q9FMU2.2|PP380_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g14080 gi|332004602|gb|AED91985.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 634 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLLNH +ALGFFN A+QQPG+SH S +Y +I KSL Sbjct: 54 IDPFLLNHHSLALGFFNWAAQQPGYSHDSISYHSIFKSL 92 >ref|XP_002873646.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319483|gb|EFH49905.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 634 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 184 IDLFLLNHPPVALGFFN*ASQQPGFSHTSSTYRAILKSL 68 ID FLLNH +ALGFFN A+QQPG+SH S +Y +I KSL Sbjct: 54 IDPFLLNHHSLALGFFNWAAQQPGYSHDSVSYHSIFKSL 92