BLASTX nr result
ID: Rauwolfia21_contig00052764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00052764 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526341.1| zinc finger protein, putative [Ricinus commu... 62 8e-08 ref|XP_006343457.1| PREDICTED: uncharacterized protein LOC102601... 60 4e-07 gb|EXB98575.1| putative E3 ubiquitin-protein ligase rbrA [Morus ... 56 6e-06 >ref|XP_002526341.1| zinc finger protein, putative [Ricinus communis] gi|223534300|gb|EEF36012.1| zinc finger protein, putative [Ricinus communis] Length = 571 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +2 Query: 131 DDHLKSLLSEQHRELMAAQALESDLLFAHQLQMQEAMNASL 253 DD L+SLLSEQ RELMAAQ+L+SDL FA QLQ+QEA+NASL Sbjct: 10 DDDLQSLLSEQRRELMAAQSLDSDLDFAFQLQLQEAINASL 50 >ref|XP_006343457.1| PREDICTED: uncharacterized protein LOC102601685 [Solanum tuberosum] Length = 526 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = +2 Query: 122 MEADDHLKSLLSEQHRELMAAQALESDLLFAHQLQMQEAMNASLPHN 262 ME +D L +LL EQ RE+ AAQA E DLLFA QLQM+EAM SLP N Sbjct: 1 MEVNDDLPALLDEQRREIAAAQAAEDDLLFAFQLQMEEAMINSLPKN 47 >gb|EXB98575.1| putative E3 ubiquitin-protein ligase rbrA [Morus notabilis] Length = 582 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +2 Query: 116 ANMEADDHLKSLLSEQHRELMAAQALESDLLFAHQLQMQEAMNASLPHNGNG 271 A+ EADD L+ +L+EQ RELMAA+ L+SDL FA Q+QMQEA+ ASL +G Sbjct: 2 ASTEADD-LQDILAEQQRELMAAKTLDSDLDFAFQIQMQEAVAASLAFRPSG 52