BLASTX nr result
ID: Rauwolfia21_contig00052561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00052561 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB75140.1| hypothetical protein L484_025916 [Morus notabilis] 59 7e-07 ref|XP_006448774.1| hypothetical protein CICLE_v10017351mg [Citr... 58 1e-06 ref|XP_003618038.1| hypothetical protein MTR_5g098300 [Medicago ... 57 2e-06 >gb|EXB75140.1| hypothetical protein L484_025916 [Morus notabilis] Length = 70 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +1 Query: 1 GRAKGRQDLRTNSQVYGVPAAPPGSDAAANTYRSPAPPPQNKLDNLNS 144 GRA+GRQD+RTN+Q+YGVPA PPG AAN + P+PPP + N++S Sbjct: 26 GRARGRQDVRTNAQIYGVPAPPPG---AANPF--PSPPPSHSKPNISS 68 >ref|XP_006448774.1| hypothetical protein CICLE_v10017351mg [Citrus clementina] gi|568828151|ref|XP_006468408.1| PREDICTED: uncharacterized protein LOC102611826 [Citrus sinensis] gi|557551385|gb|ESR62014.1| hypothetical protein CICLE_v10017351mg [Citrus clementina] Length = 80 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 1 GRAKGRQDLRTNSQVYGVPAAPPGSDAAANTYRSPAPP 114 GRA+GRQD+RTN QV+GVPA PPG+ + A T+ P+PP Sbjct: 26 GRARGRQDIRTNPQVFGVPAPPPGTGSEATTFTYPSPP 63 >ref|XP_003618038.1| hypothetical protein MTR_5g098300 [Medicago truncatula] gi|355519373|gb|AET00997.1| hypothetical protein MTR_5g098300 [Medicago truncatula] Length = 75 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = +1 Query: 1 GRAKGRQDLRTNSQVYGVPAAPPGSDAAANTYRSPAPPPQNKLDNLNS 144 GRA+GR+D+ TN QVYG+P PPG+ AA +++ S +PPPQ NL S Sbjct: 26 GRARGRRDVYTNPQVYGMPIPPPGTAAANSSFPSSSPPPQYSKPNLAS 73