BLASTX nr result
ID: Rauwolfia21_contig00050857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00050857 (519 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485890.1| PREDICTED: general transcription factor IIF ... 57 2e-06 ref|XP_006436265.1| hypothetical protein CICLE_v10032402mg [Citr... 57 2e-06 ref|XP_006360617.1| PREDICTED: general transcription factor IIF ... 56 4e-06 ref|XP_004248686.1| PREDICTED: transcription initiation factor I... 56 4e-06 >ref|XP_006485890.1| PREDICTED: general transcription factor IIF subunit 2-like isoform X1 [Citrus sinensis] Length = 274 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 517 LKLLCVYNNKGSNQGTYELKPEYKTPKDGPDS 422 LK LCVYNNKGSNQG+YELKPEYK DGP S Sbjct: 243 LKDLCVYNNKGSNQGSYELKPEYKKAADGPAS 274 >ref|XP_006436265.1| hypothetical protein CICLE_v10032402mg [Citrus clementina] gi|568865039|ref|XP_006485891.1| PREDICTED: general transcription factor IIF subunit 2-like isoform X2 [Citrus sinensis] gi|557538461|gb|ESR49505.1| hypothetical protein CICLE_v10032402mg [Citrus clementina] Length = 271 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 517 LKLLCVYNNKGSNQGTYELKPEYKTPKDGPDS 422 LK LCVYNNKGSNQG+YELKPEYK DGP S Sbjct: 240 LKDLCVYNNKGSNQGSYELKPEYKKAADGPAS 271 >ref|XP_006360617.1| PREDICTED: general transcription factor IIF subunit 2-like [Solanum tuberosum] Length = 276 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 517 LKLLCVYNNKGSNQGTYELKPEYKTPKDGPDS 422 LKLLC+YNNKG++QGTYELKPEYK +D DS Sbjct: 245 LKLLCIYNNKGAHQGTYELKPEYKRTEDKTDS 276 >ref|XP_004248686.1| PREDICTED: transcription initiation factor IIF subunit beta-like [Solanum lycopersicum] Length = 276 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 517 LKLLCVYNNKGSNQGTYELKPEYKTPKDGPDS 422 LKLLC+YNNKG++QGTYELKPEYK +D DS Sbjct: 245 LKLLCIYNNKGAHQGTYELKPEYKRAEDKTDS 276