BLASTX nr result
ID: Rauwolfia21_contig00050836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00050836 (445 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238502.1| PREDICTED: pentatricopeptide repeat-containi... 66 5e-09 ref|XP_006359053.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 gb|ESW03397.1| hypothetical protein PHAVU_011G010900g [Phaseolus... 61 2e-07 gb|EPS70180.1| hypothetical protein M569_04582 [Genlisea aurea] 56 4e-06 >ref|XP_004238502.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Solanum lycopersicum] Length = 574 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/60 (53%), Positives = 40/60 (66%) Frame = -1 Query: 184 AYVEGLVRKGTTSPHIKQLQAHLITTGLFNYHLSRAKLIDFCATSSAGSFTYAKFVFDRI 5 AYV+ L+ K T +KQLQAHLI TG F ++ RAK +DFCA SSAG+ YA +F I Sbjct: 2 AYVDSLLSKCTCFSKLKQLQAHLIITGNFQFYTCRAKFLDFCAVSSAGNLPYATHIFRHI 61 >ref|XP_006359053.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Solanum tuberosum] Length = 574 Score = 65.1 bits (157), Expect = 9e-09 Identities = 32/60 (53%), Positives = 40/60 (66%) Frame = -1 Query: 184 AYVEGLVRKGTTSPHIKQLQAHLITTGLFNYHLSRAKLIDFCATSSAGSFTYAKFVFDRI 5 AYV+ L+ K T +KQLQAHLI TG F ++ RAK +DFCA SSAG+ YA +F I Sbjct: 2 AYVDTLLSKCTCFSKLKQLQAHLIITGNFQFYTCRAKFLDFCAVSSAGNLPYATHIFRHI 61 >gb|ESW03397.1| hypothetical protein PHAVU_011G010900g [Phaseolus vulgaris] Length = 577 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/58 (50%), Positives = 42/58 (72%) Frame = -1 Query: 178 VEGLVRKGTTSPHIKQLQAHLITTGLFNYHLSRAKLIDFCATSSAGSFTYAKFVFDRI 5 ++ L++K T+ +KQLQAHLITTG F +H SRAKL++ C+ S AG ++A +F RI Sbjct: 7 LDSLLQKCTSLISMKQLQAHLITTGKFQFHPSRAKLLELCSISPAGDLSFAGQIFRRI 64 >gb|EPS70180.1| hypothetical protein M569_04582 [Genlisea aurea] Length = 577 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 2/63 (3%) Frame = -1 Query: 184 AYVEGLVRKGTTSPHIKQLQAHLITTGLFNYHLSRAKLIDFCAT--SSAGSFTYAKFVFD 11 AYVE L+ + H++Q+ AHL+ TGLF ++ RAK +D+CAT SS A F F Sbjct: 2 AYVESLLHNCASFSHVRQIHAHLLATGLFQFYPYRAKFLDYCATAFSSGLRHAVAAFPFI 61 Query: 10 RIP 2 R+P Sbjct: 62 RLP 64