BLASTX nr result
ID: Rauwolfia21_contig00050532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00050532 (506 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518907.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_002518907.1| conserved hypothetical protein [Ricinus communis] gi|223541894|gb|EEF43440.1| conserved hypothetical protein [Ricinus communis] Length = 210 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/89 (34%), Positives = 49/89 (55%) Frame = -3 Query: 441 DNLQENQKGKKISEFDKQWKNIWRTQRPTKLNLTF*TLRHDKLATASLLYNRNGADSPLC 262 D+L++N++ + W IW+ Q P K++ T L HDKL+T L R +C Sbjct: 81 DHLKDNKRANIV------WDRIWKWQGPQKVHSTLWLLAHDKLSTNKLCSQRAIIPLAIC 134 Query: 261 GISHNAVETSLHAIRNCPWSENILKGPVK 175 + + E SLHAIR+CP+++ I + VK Sbjct: 135 MHCNQSEEDSLHAIRDCPFAKIIWQKLVK 163