BLASTX nr result
ID: Rauwolfia21_contig00050019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00050019 (373 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533766.1| conserved hypothetical protein [Ricinus comm... 72 6e-11 >ref|XP_002533766.1| conserved hypothetical protein [Ricinus communis] gi|223526303|gb|EEF28611.1| conserved hypothetical protein [Ricinus communis] Length = 80 Score = 72.4 bits (176), Expect = 6e-11 Identities = 40/62 (64%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -1 Query: 292 RNSQKG*EKE*KDCWLIGSSRCESIP--FGNIVGWDRKLRNRRFEQ*NQVHLSDMTGKLS 119 R ++ E+E + CWLIGS R +P F NI GWDRKLRNRRFEQ QVH SDMTGKLS Sbjct: 21 RERERERERE-RQCWLIGS-RSNGVPHSFWNIGGWDRKLRNRRFEQLKQVHPSDMTGKLS 78 Query: 118 KG 113 KG Sbjct: 79 KG 80