BLASTX nr result
ID: Rauwolfia21_contig00050017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00050017 (330 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY30570.1| Zinc finger C-x8-C-x5-C-x3-H type family protein,... 55 1e-05 gb|AGL40443.1| C3H-type zinc finger protein [Glycine max] 55 1e-05 ref|XP_003525299.1| PREDICTED: zinc finger CCCH domain-containin... 55 1e-05 >gb|EOY30570.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma cacao] Length = 404 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 115 MVRPGFYSLPSTPTRAVA*PGIG*FDAWDKGGCEEEPV 2 ++RPGF SLPSTPTR + PGIG D WD GCEEEPV Sbjct: 292 VIRPGFCSLPSTPTRNLTRPGIGYLDFWD-NGCEEEPV 328 >gb|AGL40443.1| C3H-type zinc finger protein [Glycine max] Length = 353 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 115 MVRPGFYSLPSTPTRAVA*PGIG*FDAWDKGGCEEEPV 2 M+RPGF+SLP+TPT+A G+ FD WD+ CEEEPV Sbjct: 268 MIRPGFFSLPTTPTQAPTRGGVNYFDQWDQSCCEEEPV 305 >ref|XP_003525299.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like [Glycine max] Length = 353 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 115 MVRPGFYSLPSTPTRAVA*PGIG*FDAWDKGGCEEEPV 2 M+RPGF+SLP+TPT+A G+ FD WD+ CEEEPV Sbjct: 268 MIRPGFFSLPTTPTQAPTRGGVNYFDQWDQSCCEEEPV 305