BLASTX nr result
ID: Rauwolfia21_contig00047927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00047927 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004507683.1| PREDICTED: L-ascorbate oxidase homolog [Cice... 112 7e-23 gb|ESW25958.1| hypothetical protein PHAVU_003G080100g [Phaseolus... 110 2e-22 ref|XP_006467415.1| PREDICTED: L-ascorbate oxidase homolog [Citr... 110 3e-22 ref|XP_006449754.1| hypothetical protein CICLE_v10014825mg [Citr... 110 3e-22 ref|XP_006383902.1| multi-copper oxidase type 1 family protein [... 109 3e-22 ref|XP_002332613.1| predicted protein [Populus trichocarpa] 109 3e-22 gb|ABK95805.1| unknown [Populus trichocarpa] 109 3e-22 gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus pe... 109 4e-22 ref|XP_003549771.1| PREDICTED: L-ascorbate oxidase homolog [Glyc... 109 4e-22 ref|XP_003529638.1| PREDICTED: L-ascorbate oxidase homolog [Glyc... 109 4e-22 ref|XP_003610452.1| L-ascorbate oxidase-like protein [Medicago t... 108 1e-21 ref|XP_002269614.1| PREDICTED: L-ascorbate oxidase homolog [Viti... 107 1e-21 gb|EOY28732.1| SKU5 similar 4 isoform 3 [Theobroma cacao] 107 2e-21 gb|EOY28730.1| SKU5 similar 4 isoform 1 [Theobroma cacao] gi|508... 107 2e-21 gb|EXB37879.1| L-ascorbate oxidase-like protein [Morus notabilis] 107 2e-21 ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Frag... 107 2e-21 ref|XP_003563038.1| PREDICTED: L-ascorbate oxidase homolog [Brac... 107 2e-21 ref|XP_006657750.1| PREDICTED: L-ascorbate oxidase homolog [Oryz... 106 3e-21 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao] 106 3e-21 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus pe... 106 3e-21 >ref|XP_004507683.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum] Length = 547 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENWERQYLGQQFY+RVYTPSKS RDEYP+PKNALLCGRA GRHT Sbjct: 492 DNVGMWNIRSENWERQYLGQQFYLRVYTPSKSLRDEYPVPKNALLCGRAGGRHT 545 >gb|ESW25958.1| hypothetical protein PHAVU_003G080100g [Phaseolus vulgaris] Length = 545 Score = 110 bits (275), Expect = 2e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENWERQYLGQQFY+RVYTPS SWRDEYP+PKNA+LCGRA GR T Sbjct: 489 DNVGMWNIRSENWERQYLGQQFYLRVYTPSGSWRDEYPVPKNAVLCGRASGRRT 542 >ref|XP_006467415.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis] Length = 543 Score = 110 bits (274), Expect = 3e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDE PIPKNALLCGRARGRHT Sbjct: 487 DNVGMWNIRSENWARQYLGQQFYLRVYSPANSWRDELPIPKNALLCGRARGRHT 540 >ref|XP_006449754.1| hypothetical protein CICLE_v10014825mg [Citrus clementina] gi|557552365|gb|ESR62994.1| hypothetical protein CICLE_v10014825mg [Citrus clementina] Length = 543 Score = 110 bits (274), Expect = 3e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDE PIPKNALLCGRARGRHT Sbjct: 487 DNVGMWNIRSENWARQYLGQQFYLRVYSPANSWRDELPIPKNALLCGRARGRHT 540 >ref|XP_006383902.1| multi-copper oxidase type 1 family protein [Populus trichocarpa] gi|550340052|gb|ERP61699.1| multi-copper oxidase type 1 family protein [Populus trichocarpa] Length = 544 Score = 109 bits (273), Expect = 3e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDE PIPKNALLCGRARGRHT Sbjct: 488 DNVGMWNIRSENWARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCGRARGRHT 541 >ref|XP_002332613.1| predicted protein [Populus trichocarpa] Length = 544 Score = 109 bits (273), Expect = 3e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDE PIPKNALLCGRARGRHT Sbjct: 488 DNVGMWNIRSENWARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCGRARGRHT 541 >gb|ABK95805.1| unknown [Populus trichocarpa] Length = 544 Score = 109 bits (273), Expect = 3e-22 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDE PIPKNALLCGRARGRHT Sbjct: 488 DNVGMWNIRSENWARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCGRARGRHT 541 >gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica] Length = 543 Score = 109 bits (272), Expect = 4e-22 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDEYPIP+NALLCGRARGR T Sbjct: 487 DNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRARGRRT 540 >ref|XP_003549771.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max] Length = 549 Score = 109 bits (272), Expect = 4e-22 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQ Y+RVYTPSKSWRDEYP+PKNALLCGRA GR T Sbjct: 493 DNVGMWNIRSENWGRQYLGQQLYLRVYTPSKSWRDEYPVPKNALLCGRASGRRT 546 >ref|XP_003529638.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max] Length = 547 Score = 109 bits (272), Expect = 4e-22 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQ Y+RVYTPSKSWRDEYP+PKNALLCGRA GR T Sbjct: 491 DNVGMWNIRSENWGRQYLGQQLYLRVYTPSKSWRDEYPVPKNALLCGRASGRRT 544 >ref|XP_003610452.1| L-ascorbate oxidase-like protein [Medicago truncatula] gi|355511507|gb|AES92649.1| L-ascorbate oxidase-like protein [Medicago truncatula] Length = 545 Score = 108 bits (269), Expect = 1e-21 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENWERQYLGQQFY+RVYTPSKS RDEYP+PKNALLCGRA GR T Sbjct: 489 DNVGMWNIRSENWERQYLGQQFYLRVYTPSKSLRDEYPVPKNALLCGRASGRVT 542 >ref|XP_002269614.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera] gi|297739160|emb|CBI28811.3| unnamed protein product [Vitis vinifera] Length = 541 Score = 107 bits (268), Expect = 1e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDEYPIPKNALLCGRA GR T Sbjct: 485 DNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPKNALLCGRASGRKT 538 >gb|EOY28732.1| SKU5 similar 4 isoform 3 [Theobroma cacao] Length = 543 Score = 107 bits (267), Expect = 2e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDE PIPKNA LCGRARGRHT Sbjct: 487 DNVGMWNIRSENWARQYLGQQFYLRVYSPANSWRDELPIPKNAPLCGRARGRHT 540 >gb|EOY28730.1| SKU5 similar 4 isoform 1 [Theobroma cacao] gi|508781475|gb|EOY28731.1| SKU5 similar 4 isoform 1 [Theobroma cacao] Length = 542 Score = 107 bits (267), Expect = 2e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDE PIPKNA LCGRARGRHT Sbjct: 486 DNVGMWNIRSENWARQYLGQQFYLRVYSPANSWRDELPIPKNAPLCGRARGRHT 539 >gb|EXB37879.1| L-ascorbate oxidase-like protein [Morus notabilis] Length = 232 Score = 107 bits (266), Expect = 2e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDEYPIPKNALLCGRA GR T Sbjct: 176 DNVGMWNIRSENWARQYLGQQFYLRVYSPANSWRDEYPIPKNALLCGRAVGRRT 229 >ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. vesca] Length = 542 Score = 107 bits (266), Expect = 2e-21 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P SWRDEYPIPKNALLCGRA GR T Sbjct: 486 DNVGMWNVRSENWARQYLGQQFYLRVYSPVNSWRDEYPIPKNALLCGRASGRRT 539 >ref|XP_003563038.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon] Length = 543 Score = 107 bits (266), Expect = 2e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RV+TPS SWRDE+PIPKNALLCGRA GR T Sbjct: 487 DNVGMWNVRSENWARQYLGQQFYLRVWTPSTSWRDEFPIPKNALLCGRAAGRRT 540 >ref|XP_006657750.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha] Length = 551 Score = 106 bits (265), Expect = 3e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSE+W RQYLGQQFY+RV+TPS SWRDEYPIPKNALLCGRA GR T Sbjct: 495 DNVGMWNVRSESWARQYLGQQFYLRVWTPSTSWRDEYPIPKNALLCGRAAGRRT 548 >gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao] Length = 540 Score = 106 bits (265), Expect = 3e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+KSWRDEYPIP+NALLCGRA G+ T Sbjct: 487 DNVGMWNVRSENWARQYLGQQFYLRVYSPAKSWRDEYPIPRNALLCGRAVGQRT 540 >gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica] Length = 542 Score = 106 bits (265), Expect = 3e-21 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 265 DNVGMWNTRSENWERQYLGQQFYMRVYTPSKSWRDEYPIPKNALLCGRARGRHT 104 DNVGMWN RSENW RQYLGQQFY+RVY+P+ SWRDEYPIP+NALLCGRA GR T Sbjct: 486 DNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRALGRRT 539