BLASTX nr result
ID: Rauwolfia21_contig00047920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00047920 (376 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362933.1| PREDICTED: uncharacterized protein DDB_G0271... 75 7e-12 ref|XP_004248504.1| PREDICTED: uncharacterized protein LOC101243... 66 5e-09 ref|XP_002521829.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 emb|CBI20378.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002316934.1| cyclic nucleotide-gated channel [Populus tri... 63 3e-08 ref|XP_002330422.1| predicted protein [Populus trichocarpa] gi|5... 60 2e-07 ref|XP_004294487.1| PREDICTED: uncharacterized protein LOC101291... 57 3e-06 ref|XP_006464670.1| PREDICTED: uncharacterized protein DDB_G0271... 56 6e-06 >ref|XP_006362933.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Solanum tuberosum] Length = 473 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -1 Query: 154 NGVSR--RKMSETDDKHWDFLDEIEAPLWVDLTLECQSGYSDKDDEWFHVIHP 2 NGV +K +E D HW FLD+IEAP+WVDLTLEC+S Y D DDEWFH+ HP Sbjct: 22 NGVENLSKKYNEQFD-HWAFLDQIEAPVWVDLTLECKSAYKDMDDEWFHISHP 73 >ref|XP_004248504.1| PREDICTED: uncharacterized protein LOC101243644 [Solanum lycopersicum] Length = 463 Score = 65.9 bits (159), Expect = 5e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 112 HWDFLDEIEAPLWVDLTLECQSGYSDKDDEWFH 14 HW FLD+IEAP+WVDLTLEC+S Y D D+EWFH Sbjct: 33 HWAFLDQIEAPVWVDLTLECKSAYKDMDEEWFH 65 >ref|XP_002521829.1| conserved hypothetical protein [Ricinus communis] gi|223539042|gb|EEF40639.1| conserved hypothetical protein [Ricinus communis] Length = 373 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -1 Query: 112 HWDFLDEIEAPLWVDLTLECQSGYSDKDDEWFHVIH 5 HW FLDEIEAP+WVDLTLE S Y+D DD WFH H Sbjct: 14 HWAFLDEIEAPMWVDLTLEANSNYTDVDDGWFHTSH 49 >emb|CBI20378.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -1 Query: 133 MSETDDKHWDFLDEIEAPLWVDLTLECQSGYSDKDDEWFHVIHP 2 + +TDD HW FL+E EAP+W DLTLE ++ D DD+WFH+ HP Sbjct: 3 LKKTDD-HWAFLEEFEAPMWADLTLEAKTNNQDVDDKWFHISHP 45 >ref|XP_002316934.1| cyclic nucleotide-gated channel [Populus trichocarpa] Length = 565 Score = 63.2 bits (152), Expect = 3e-08 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -1 Query: 112 HWDFLDEIEAPLWVDLTLECQSGYSDKDDEWFHVIHP 2 HW FL+EIEAP+WVD T+E +S Y D DD+WFH HP Sbjct: 10 HWAFLEEIEAPMWVDFTIEEKSNYQDVDDKWFHTSHP 46 >ref|XP_002330422.1| predicted protein [Populus trichocarpa] gi|566154168|ref|XP_006370339.1| hypothetical protein POPTR_0001s41790g [Populus trichocarpa] gi|550349518|gb|ERP66908.1| hypothetical protein POPTR_0001s41790g [Populus trichocarpa] Length = 490 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -1 Query: 112 HWDFLDEIEAPLWVDLTLECQSGYSDKDDEWFHVIHP 2 HW FL+EIEAP+WVD +E +S Y D DDEWF HP Sbjct: 10 HWAFLEEIEAPIWVDFLVEAKSNYQDVDDEWFRTSHP 46 >ref|XP_004294487.1| PREDICTED: uncharacterized protein LOC101291124 [Fragaria vesca subsp. vesca] Length = 455 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -1 Query: 112 HWDFLDEIEAPLWVDLTLECQSGYSDKDDEWFHVIH 5 HWDFL+EIEAP+WVDL E S D DD+WF+ H Sbjct: 6 HWDFLEEIEAPMWVDLESEVNSNKQDGDDDWFYTSH 41 >ref|XP_006464670.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus sinensis] Length = 492 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 1/37 (2%) Frame = -1 Query: 112 HWDFLDEIEAPLWVDLTLECQSGYS-DKDDEWFHVIH 5 HW FLDEIEAP+WVDLTLE + S D DDEWFH H Sbjct: 9 HWAFLDEIEAPMWVDLTLEDATYNSQDVDDEWFHSSH 45