BLASTX nr result
ID: Rauwolfia21_contig00047737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00047737 (503 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67155.1| hypothetical protein M569_07622, partial [Genlise... 55 7e-06 >gb|EPS67155.1| hypothetical protein M569_07622, partial [Genlisea aurea] Length = 201 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/56 (44%), Positives = 40/56 (71%) Frame = +3 Query: 291 MGGSQTKEKSNILSNEKIVESLKNKIRLLQGEVNDILGMRDAEIQAYEREMMVFAF 458 MG SQ+ K N S I+E+LK K++ L+ E++D++ +R+AE + YERE++ FAF Sbjct: 1 MGSSQSHPKKNKSSTSTIMEALKKKVKFLEEEIHDVMCIREAENKVYERELVGFAF 56