BLASTX nr result
ID: Rauwolfia21_contig00045874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00045874 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298866.1| PREDICTED: NADP-dependent alkenal double bon... 62 8e-08 gb|EMJ03629.1| hypothetical protein PRUPE_ppa009819mg [Prunus pe... 62 8e-08 ref|XP_004488361.1| PREDICTED: NADP-dependent alkenal double bon... 60 4e-07 ref|XP_002285167.1| PREDICTED: NADP-dependent alkenal double bon... 59 7e-07 emb|CAN65024.1| hypothetical protein VITISV_026273 [Vitis vinifera] 59 7e-07 gb|EOY31050.1| NADP-dependent alkenal double bond reductase P1 [... 59 9e-07 ref|XP_006360352.1| PREDICTED: NADP-dependent alkenal double bon... 58 1e-06 ref|XP_002265626.1| PREDICTED: NADP-dependent alkenal double bon... 57 2e-06 ref|XP_002524486.1| alcohol dehydrogenase, putative [Ricinus com... 57 2e-06 gb|AFW87171.1| putative alcohol dehydrogenase superfamily protei... 57 3e-06 gb|AFK42339.1| unknown [Medicago truncatula] 57 3e-06 ref|NP_001147559.1| NADP-dependent oxidoreductase P2 [Zea mays] ... 57 3e-06 ref|XP_003563667.1| PREDICTED: NADP-dependent alkenal double bon... 56 6e-06 >ref|XP_004298866.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like [Fragaria vesca subsp. vesca] Length = 347 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 252 LTAFSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 + FSG TAYGGFFEVCKPKKGEKVFVSAASG Sbjct: 137 ILGFSGLTAYGGFFEVCKPKKGEKVFVSAASG 168 >gb|EMJ03629.1| hypothetical protein PRUPE_ppa009819mg [Prunus persica] Length = 276 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 252 LTAFSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 + FSG TAYGGFFEVCKPKKGEKVFVSAASG Sbjct: 79 ILGFSGLTAYGGFFEVCKPKKGEKVFVSAASG 110 >ref|XP_004488361.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like [Cicer arietinum] Length = 346 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 261 FSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 FSG TAYGGFFE+CKP+KGEKVFVSAASG Sbjct: 139 FSGLTAYGGFFEICKPQKGEKVFVSAASG 167 >ref|XP_002285167.1| PREDICTED: NADP-dependent alkenal double bond reductase P1 [Vitis vinifera] gi|297738946|emb|CBI28191.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 252 LTAFSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 + FSG TA+GGFF+VCKPKKGEKVFVSAASG Sbjct: 136 ILGFSGLTAHGGFFQVCKPKKGEKVFVSAASG 167 >emb|CAN65024.1| hypothetical protein VITISV_026273 [Vitis vinifera] Length = 805 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 252 LTAFSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 + FSG TA+GGFF+VCKPKKGEKVFVSAASG Sbjct: 138 ILGFSGLTAHGGFFQVCKPKKGEKVFVSAASG 169 >gb|EOY31050.1| NADP-dependent alkenal double bond reductase P1 [Theobroma cacao] Length = 346 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 252 LTAFSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 + FSG TAY GFFEVCKPK+GEKVFVSAASG Sbjct: 136 ILGFSGLTAYAGFFEVCKPKRGEKVFVSAASG 167 >ref|XP_006360352.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Solanum tuberosum] Length = 349 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +3 Query: 261 FSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 FSG TAYGGFFEVCKPK GEKVFVSA SG Sbjct: 142 FSGLTAYGGFFEVCKPKPGEKVFVSAGSG 170 >ref|XP_002265626.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Vitis vinifera] gi|297735440|emb|CBI17880.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 264 SGFTAYGGFFEVCKPKKGEKVFVSAASG 347 SG TAYGGFFEVCKPKKGEKVFVSAA G Sbjct: 141 SGLTAYGGFFEVCKPKKGEKVFVSAACG 168 >ref|XP_002524486.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223536274|gb|EEF37926.1| alcohol dehydrogenase, putative [Ricinus communis] Length = 346 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 252 LTAFSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 + FSG TAY G FEVCKPKKGEKVFVSAASG Sbjct: 136 ILGFSGLTAYAGLFEVCKPKKGEKVFVSAASG 167 >gb|AFW87171.1| putative alcohol dehydrogenase superfamily protein [Zea mays] Length = 356 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 264 SGFTAYGGFFEVCKPKKGEKVFVSAASG 347 SG TAYGGFFEVCKP KGEKVFVSAASG Sbjct: 152 SGMTAYGGFFEVCKPVKGEKVFVSAASG 179 >gb|AFK42339.1| unknown [Medicago truncatula] Length = 346 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 252 LTAFSGFTAYGGFFEVCKPKKGEKVFVSAASG 347 + FSG +AYGGFFE+CKP+KGE VFVSAASG Sbjct: 136 ILGFSGLSAYGGFFEICKPRKGETVFVSAASG 167 >ref|NP_001147559.1| NADP-dependent oxidoreductase P2 [Zea mays] gi|195612186|gb|ACG27923.1| NADP-dependent oxidoreductase P2 [Zea mays] gi|413954521|gb|AFW87170.1| putative alcohol dehydrogenase superfamily protein [Zea mays] Length = 343 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 264 SGFTAYGGFFEVCKPKKGEKVFVSAASG 347 SG TAYGGFFEVCKP KGEKVFVSAASG Sbjct: 139 SGMTAYGGFFEVCKPVKGEKVFVSAASG 166 >ref|XP_003563667.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Brachypodium distachyon] Length = 344 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 264 SGFTAYGGFFEVCKPKKGEKVFVSAASG 347 SG TAYGGF+EVCKPKKGE VFVSAASG Sbjct: 140 SGMTAYGGFYEVCKPKKGETVFVSAASG 167