BLASTX nr result
ID: Rauwolfia21_contig00044888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00044888 (388 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY11265.1| Autophagy 18 H [Theobroma cacao] 59 9e-07 ref|XP_002512317.1| ATP binding protein, putative [Ricinus commu... 57 2e-06 >gb|EOY11265.1| Autophagy 18 H [Theobroma cacao] Length = 1402 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/55 (54%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +1 Query: 1 VKVLRSGDGDL--ECRREHHRRVVQRTYSEELLDVEEYNSTKHLNALSQKLKELA 159 V +L GD + +C +E HRR +QRTYS ELLD +EYNSTKHLN ++ +L+E+A Sbjct: 430 VVILLRGDEYVAADCAKEPHRRSIQRTYSNELLDAQEYNSTKHLNNIN-RLREIA 483 >ref|XP_002512317.1| ATP binding protein, putative [Ricinus communis] gi|223548278|gb|EEF49769.1| ATP binding protein, putative [Ricinus communis] Length = 436 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = +1 Query: 1 VKVLRSGDGDLECRREHHRRVVQRTYSEELLDVEEYNSTKHLNALSQKLKELA 159 V +LR + EC +E+ R+ +QRTYSEELLD +EYNSTK+LN L ++ KELA Sbjct: 382 VILLRGDEYVRECAKENQRKTLQRTYSEELLDAQEYNSTKYLNDL-KRHKELA 433