BLASTX nr result
ID: Rauwolfia21_contig00044628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00044628 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291856.1| PREDICTED: glucose-1-phosphate adenylyltrans... 63 5e-08 gb|EMJ23720.1| hypothetical protein PRUPE_ppa004135mg [Prunus pe... 63 5e-08 gb|AFO84073.1| ADP glucose pyrophosphorylase [Actinidia deliciosa] 60 3e-07 gb|EXC25068.1| Glucose-1-phosphate adenylyltransferase large sub... 60 4e-07 gb|AGB85111.1| ADP-glucose pyrophosphorylase large subunit 3 [Ip... 60 4e-07 gb|AFL55398.1| ADP-glucose pyrophosphorylase large subunit 3 [Ip... 60 4e-07 dbj|BAF47748.1| ADP-glucose pyrophosphorylase beta subunit IbAGP... 60 4e-07 ref|XP_002281223.1| PREDICTED: glucose-1-phosphate adenylyltrans... 59 7e-07 gb|EOY14815.1| ADPGLC-PPase large subunit isoform 1 [Theobroma c... 59 9e-07 gb|ADN34184.1| ADP-glucose pyrophosphorylase large subunit [Cucu... 58 1e-06 gb|AAB91468.1| ADP-glucose pyrophosphorylase large subunit 2 [Ci... 58 1e-06 gb|EPS60253.1| glucose-1-phosphate adenylyltransferase, partial ... 58 1e-06 gb|EMT32758.1| hypothetical protein F775_52189 [Aegilops tauschii] 58 1e-06 gb|ESW08615.1| hypothetical protein PHAVU_009G059800g [Phaseolus... 57 2e-06 gb|ESW08614.1| hypothetical protein PHAVU_009G059800g [Phaseolus... 57 2e-06 gb|ESW08613.1| hypothetical protein PHAVU_009G059800g [Phaseolus... 57 2e-06 ref|XP_002300758.1| ADP-glucose pyrophosphorylase large subunit ... 57 2e-06 ref|XP_006581201.1| PREDICTED: glucose-1-phosphate adenylyltrans... 57 3e-06 ref|XP_006577992.1| PREDICTED: glucose-1-phosphate adenylyltrans... 57 3e-06 gb|ESW08617.1| hypothetical protein PHAVU_009G059800g [Phaseolus... 57 3e-06 >ref|XP_004291856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic-like [Fragaria vesca subsp. vesca] Length = 521 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+FNDPK PFYTSPR+LPPTKVE+CR Sbjct: 368 QPPKFEFNDPKTPFYTSPRFLPPTKVEKCR 397 >gb|EMJ23720.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica] Length = 527 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+FNDPK PFYTSPR+LPPTKVE+CR Sbjct: 374 QPPKFEFNDPKTPFYTSPRFLPPTKVEKCR 403 >gb|AFO84073.1| ADP glucose pyrophosphorylase [Actinidia deliciosa] Length = 520 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 102 AFLLQPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 A QP KFDFNDPK PF TSPR+LPPTK+E+CR Sbjct: 363 ALTKQPPKFDFNDPKTPFCTSPRFLPPTKMEKCR 396 >gb|EXC25068.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus notabilis] Length = 524 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PFYTSPR+LPPTKVE+CR Sbjct: 371 QPPKFEFYDPKTPFYTSPRFLPPTKVEKCR 400 >gb|AGB85111.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas] Length = 517 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP FDFNDPK PFYTSPR+LPPTKV++C+ Sbjct: 364 QPPMFDFNDPKTPFYTSPRFLPPTKVDKCK 393 >gb|AFL55398.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas] Length = 518 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP FDFNDPK PFYTSPR+LPPTKV++C+ Sbjct: 365 QPPMFDFNDPKTPFYTSPRFLPPTKVDKCK 394 >dbj|BAF47748.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb2 [Ipomoea batatas] Length = 518 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP FDFNDPK PFYTSPR+LPPTKV++C+ Sbjct: 365 QPPMFDFNDPKTPFYTSPRFLPPTKVDKCK 394 >ref|XP_002281223.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic/amyloplastic [Vitis vinifera] gi|302142527|emb|CBI19730.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PFYTSPR+LPPTKVE CR Sbjct: 371 QPPKFEFYDPKTPFYTSPRFLPPTKVEECR 400 >gb|EOY14815.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao] Length = 526 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PFYTSPR+LPPTKV++CR Sbjct: 373 QPPKFEFYDPKTPFYTSPRFLPPTKVDKCR 402 >gb|ADN34184.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo subsp. melo] Length = 533 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PFYTSPR+LPP+KVE+CR Sbjct: 380 QPPKFEFYDPKTPFYTSPRFLPPSKVEKCR 409 >gb|AAB91468.1| ADP-glucose pyrophosphorylase large subunit 2 [Citrullus lanatus subsp. vulgaris] Length = 481 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PFYTSPR+LPP+KVE+CR Sbjct: 328 QPPKFEFYDPKTPFYTSPRFLPPSKVEKCR 357 >gb|EPS60253.1| glucose-1-phosphate adenylyltransferase, partial [Genlisea aurea] Length = 481 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 Q KF FNDPK PFYTSP YLPPTKVE+CR Sbjct: 316 QSPKFSFNDPKTPFYTSPLYLPPTKVEKCR 345 >gb|EMT32758.1| hypothetical protein F775_52189 [Aegilops tauschii] Length = 574 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 93 LQPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 LQP KF+F DPK PF+TSPRYLPPTK ++CR Sbjct: 374 LQPPKFEFYDPKTPFFTSPRYLPPTKSDKCR 404 >gb|ESW08615.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris] Length = 310 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 93 LQPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 +QP KF+F DPK PF+TSPR+LPPTKVE+C+ Sbjct: 156 VQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK 186 >gb|ESW08614.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris] Length = 369 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 93 LQPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 +QP KF+F DPK PF+TSPR+LPPTKVE+C+ Sbjct: 215 VQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK 245 >gb|ESW08613.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris] Length = 338 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 93 LQPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 +QP KF+F DPK PF+TSPR+LPPTKVE+C+ Sbjct: 184 VQPPKFEFYDPKTPFFTSPRFLPPTKVEKCK 214 >ref|XP_002300758.1| ADP-glucose pyrophosphorylase large subunit 2 family protein [Populus trichocarpa] gi|222842484|gb|EEE80031.1| ADP-glucose pyrophosphorylase large subunit 2 family protein [Populus trichocarpa] Length = 528 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 138 IFNI*AVHDKY*AFLLQPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 I I ++ D A QP KF+F DPK PF+TSPR+LPPTKV++CR Sbjct: 359 IGTIKSLFDANLALTEQPPKFEFYDPKTPFFTSPRFLPPTKVDKCR 404 >ref|XP_006581201.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic isoform X2 [Glycine max] Length = 502 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PF+TSPR+LPPTKVE+C+ Sbjct: 378 QPPKFEFYDPKTPFFTSPRFLPPTKVEKCK 407 >ref|XP_006577992.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic-like isoform X2 [Glycine max] Length = 494 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PF+TSPR+LPPTKVE+C+ Sbjct: 377 QPPKFEFYDPKTPFFTSPRFLPPTKVEKCK 406 >gb|ESW08617.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris] Length = 337 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 90 QPSKFDFNDPKNPFYTSPRYLPPTKVERCR 1 QP KF+F DPK PF+TSPR+LPPTKVE+C+ Sbjct: 184 QPPKFEFYDPKTPFFTSPRFLPPTKVEKCK 213