BLASTX nr result
ID: Rauwolfia21_contig00044328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00044328 (263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomen... 58 1e-06 emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] 58 1e-06 ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicot... 58 1e-06 >ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomentosiformis] gi|80750905|dbj|BAE47981.1| hypothetical protein [Nicotiana tomentosiformis] Length = 90 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 263 RGIRTLGTNNSYNGLAIRRFSPLSHLSKLK 174 RGIRTLGT NSYNGLAIRRFSPLSHLS+LK Sbjct: 56 RGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85 >emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] Length = 90 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 263 RGIRTLGTNNSYNGLAIRRFSPLSHLSKLK 174 RGIRTLGT NSYNGLAIRRFSPLSHLS+LK Sbjct: 56 RGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85 >ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453885|gb|AEO95543.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453996|gb|AEO95653.1| hypothetical protein [synthetic construct] Length = 90 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 263 RGIRTLGTNNSYNGLAIRRFSPLSHLSKLK 174 RGIRTLGT NSYNGLAIRRFSPLSHLS+LK Sbjct: 56 RGIRTLGTINSYNGLAIRRFSPLSHLSQLK 85