BLASTX nr result
ID: Rauwolfia21_contig00044110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00044110 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338806.1| PREDICTED: pentatricopeptide repeat-containi... 69 6e-10 ref|XP_002273841.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 emb|CAN70049.1| hypothetical protein VITISV_013371 [Vitis vinifera] 66 4e-09 ref|XP_004233586.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006447073.1| hypothetical protein CICLE_v10018352mg [Citr... 55 7e-06 >ref|XP_006338806.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Solanum tuberosum] Length = 477 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +3 Query: 126 TITSLPFVHLQPKPSNLSLLADQCTSMRQLKQIHAKMIVTSRVHDNYAASR 278 +IT +P P +LSLLADQCTS+ QLKQIHA+MI+++R+HDNYAASR Sbjct: 16 SITYVPSAPPSRNPPHLSLLADQCTSLHQLKQIHAQMIISARIHDNYAASR 66 >ref|XP_002273841.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Vitis vinifera] Length = 474 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 159 PKPSNLSLLADQCTSMRQLKQIHAKMIVTSRVHDNYAASR 278 P P SLLAD+CTSM QLKQIHA+MIV++R+HDNYAASR Sbjct: 24 PPPPRFSLLADKCTSMHQLKQIHAQMIVSARIHDNYAASR 63 >emb|CAN70049.1| hypothetical protein VITISV_013371 [Vitis vinifera] Length = 476 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 159 PKPSNLSLLADQCTSMRQLKQIHAKMIVTSRVHDNYAASR 278 P P SLLAD+CTSM QLKQIHA+MIV++R+HDNYAASR Sbjct: 26 PPPPRXSLLADKCTSMHQLKQIHAQMIVSARIHDNYAASR 65 >ref|XP_004233586.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Solanum lycopersicum] Length = 477 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +3 Query: 165 PSNLSLLADQCTSMRQLKQIHAKMIVTSRVHDNYAASR 278 P +LSLLADQCTS+ QLKQIHA+MIV +R+HDN+AASR Sbjct: 29 PPHLSLLADQCTSLHQLKQIHAQMIVRARIHDNFAASR 66 >ref|XP_006447073.1| hypothetical protein CICLE_v10018352mg [Citrus clementina] gi|568831618|ref|XP_006470058.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Citrus sinensis] gi|557549684|gb|ESR60313.1| hypothetical protein CICLE_v10018352mg [Citrus clementina] Length = 463 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = +3 Query: 174 LSLLADQCTSMRQLKQIHAKMIVTSRVHDNYAASR 278 LSLLAD+C SM QLKQIHA+MI++SR+ D++AASR Sbjct: 18 LSLLADKCKSMHQLKQIHAQMIISSRIQDHFAASR 52