BLASTX nr result
ID: Rauwolfia21_contig00042714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00042714 (206 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY32350.1| Phosphatase 2A-3 [Theobroma cacao] 58 1e-06 >gb|EOY32350.1| Phosphatase 2A-3 [Theobroma cacao] Length = 350 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 TICGDIHGQFHDLAELFRIGGKVLLSAIRSLFLFPC 110 TICGDIHGQFHDLAELFRIGGKV++ ++ F C Sbjct: 56 TICGDIHGQFHDLAELFRIGGKVIVLIEAAILCFKC 91