BLASTX nr result
ID: Rauwolfia21_contig00042631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00042631 (207 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843165.1| hypothetical protein AMTR_s00146p00052750 [A... 58 1e-06 ref|XP_006453045.1| hypothetical protein CICLE_v10010008mg [Citr... 54 8e-06 >ref|XP_006843165.1| hypothetical protein AMTR_s00146p00052750 [Amborella trichopoda] gi|548845389|gb|ERN04840.1| hypothetical protein AMTR_s00146p00052750 [Amborella trichopoda] Length = 69 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 207 KFLKGQWDKEDCVSEWQKYRECLSVSSSFFGR 112 K+LKGQWDKE+CVSEW KYR CL VS +FF R Sbjct: 36 KYLKGQWDKEECVSEWGKYRACLVVSGNFFYR 67 >ref|XP_006453045.1| hypothetical protein CICLE_v10010008mg [Citrus clementina] gi|557556271|gb|ESR66285.1| hypothetical protein CICLE_v10010008mg [Citrus clementina] Length = 100 Score = 53.9 bits (128), Expect(2) = 8e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 207 KFLKGQWDKEDCVSEWQKYRECLS 136 KF+KGQWDKE+CVSEWQKYR CLS Sbjct: 38 KFVKGQWDKEECVSEWQKYRACLS 61 Score = 21.2 bits (43), Expect(2) = 8e-06 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 28 LQQHLDDKH 2 L +HLDDKH Sbjct: 60 LSEHLDDKH 68