BLASTX nr result
ID: Rauwolfia21_contig00042091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00042091 (284 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ05696.1| hypothetical protein PRUPE_ppa019362mg [Prunus pe... 57 2e-06 >gb|EMJ05696.1| hypothetical protein PRUPE_ppa019362mg [Prunus persica] Length = 558 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = +3 Query: 123 WTWQRRISSLSVSNFRVPAPTQLNELLQYCSNSEALNPGKQTHQKIVIHGLQGN 284 W R IS LS +N + P+P++L LQ CSNS++LN GK HQKI+ GL N Sbjct: 4 WRAHRAISILSTTNSKAPSPSELGVYLQLCSNSKSLNQGKHVHQKIIQCGLDQN 57