BLASTX nr result
ID: Rauwolfia21_contig00039480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00039480 (299 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303888.1| ovule development family protein [Populus tr... 67 2e-09 gb|EXB93273.1| AP2-like ethylene-responsive transcription factor... 67 3e-09 gb|AGY29599.1| AP2 class putative transcription factor [Rosa can... 66 4e-09 ref|XP_002299238.2| ovule development family protein [Populus tr... 64 3e-08 ref|XP_004295184.1| PREDICTED: AP2-like ethylene-responsive tran... 64 3e-08 ref|XP_002333909.1| AP2 domain-containing transcription factor [... 64 3e-08 gb|EOY32584.1| AP2 domain-containing transcription factor [Theob... 62 6e-08 ref|XP_002285539.1| PREDICTED: AP2-like ethylene-responsive tran... 60 2e-07 emb|CAN74963.1| hypothetical protein VITISV_011083 [Vitis vinifera] 60 2e-07 ref|XP_004169847.1| PREDICTED: LOW QUALITY PROTEIN: AP2-like eth... 60 3e-07 ref|XP_004142127.1| PREDICTED: AP2-like ethylene-responsive tran... 60 3e-07 ref|XP_002535292.1| Protein BABY BOOM, putative [Ricinus communi... 60 3e-07 ref|XP_006467192.1| PREDICTED: AP2-like ethylene-responsive tran... 60 4e-07 ref|XP_006446069.1| hypothetical protein CICLE_v10014809mg [Citr... 60 4e-07 emb|CBI16410.3| unnamed protein product [Vitis vinifera] 55 7e-06 >ref|XP_002303888.1| ovule development family protein [Populus trichocarpa] gi|222841320|gb|EEE78867.1| ovule development family protein [Populus trichocarpa] Length = 524 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 SAEELALVKVDYDM S+ Y + WSG+SVQGSNP VFTMWN+ Sbjct: 485 SAEELALVKVDYDMPSSGYGS-WSGDSVQGSNPGVFTMWNE 524 >gb|EXB93273.1| AP2-like ethylene-responsive transcription factor PLT2 [Morus notabilis] Length = 573 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 +AEELALVKVDYDM S + GWSG S QGSNPSVFTMWND Sbjct: 533 TAEELALVKVDYDMTSGSGYGGWSGGSGQGSNPSVFTMWND 573 >gb|AGY29599.1| AP2 class putative transcription factor [Rosa canina] Length = 556 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 SAEELALVKVDYDM S Y + WSG SVQGSNP VFTMWND Sbjct: 517 SAEELALVKVDYDMPSGGYGS-WSGGSVQGSNPGVFTMWND 556 >ref|XP_002299238.2| ovule development family protein [Populus trichocarpa] gi|550346582|gb|EEE84043.2| ovule development family protein [Populus trichocarpa] Length = 545 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 5 AEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 AEEL LVK+DYDM S Y + WSGESVQGSNP VFTMWN+ Sbjct: 507 AEELPLVKIDYDMPSGGYGS-WSGESVQGSNPGVFTMWNE 545 >ref|XP_004295184.1| PREDICTED: AP2-like ethylene-responsive transcription factor PLT2-like [Fragaria vesca subsp. vesca] Length = 554 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 SAEELALVKVDYD+ S Y + WSG SVQGSNP VFTMWN+ Sbjct: 515 SAEELALVKVDYDLPSGGYGS-WSGGSVQGSNPGVFTMWNE 554 >ref|XP_002333909.1| AP2 domain-containing transcription factor [Populus trichocarpa] Length = 219 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 5 AEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 AEEL LVK+DYDM S Y + WSGESVQGSNP VFTMWN+ Sbjct: 181 AEELPLVKIDYDMPSGGYGS-WSGESVQGSNPGVFTMWNE 219 >gb|EOY32584.1| AP2 domain-containing transcription factor [Theobroma cacao] Length = 541 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 S EELALVKVDYDM S Y GWSG+SVQG+N VF+MWND Sbjct: 502 STEELALVKVDYDMPSGGYG-GWSGDSVQGTNAGVFSMWND 541 >ref|XP_002285539.1| PREDICTED: AP2-like ethylene-responsive transcription factor PLT2-like [Vitis vinifera] Length = 552 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 SAEEL L+KVDYDM + Y + WSG+SVQG N VFTMWND Sbjct: 513 SAEELPLIKVDYDMPAAGYGS-WSGDSVQGQNAGVFTMWND 552 >emb|CAN74963.1| hypothetical protein VITISV_011083 [Vitis vinifera] Length = 552 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 SAEEL L+KVDYDM + Y + WSG+SVQG N VFTMWND Sbjct: 513 SAEELPLIKVDYDMPAAGYGS-WSGDSVQGQNAGVFTMWND 552 >ref|XP_004169847.1| PREDICTED: LOW QUALITY PROTEIN: AP2-like ethylene-responsive transcription factor PLT2-like [Cucumis sativus] Length = 551 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 +AEE ALVKVDYDM ++ GW+G+SVQGSN VF+MWND Sbjct: 511 TAEEYALVKVDYDMPNSGGYGGWTGDSVQGSNAGVFSMWND 551 >ref|XP_004142127.1| PREDICTED: AP2-like ethylene-responsive transcription factor PLT2-like [Cucumis sativus] Length = 557 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 +AEE ALVKVDYDM ++ GW+G+SVQGSN VF+MWND Sbjct: 517 TAEEYALVKVDYDMPNSGGYGGWTGDSVQGSNAGVFSMWND 557 >ref|XP_002535292.1| Protein BABY BOOM, putative [Ricinus communis] gi|223523529|gb|EEF27090.1| Protein BABY BOOM, putative [Ricinus communis] Length = 302 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 5 AEELALVKVDYDMASTTYSTGWSGESVQGSNP-SVFTMWND 124 AEE+ALVKVDYDM S Y WSG+SVQGSNP VFTMWND Sbjct: 263 AEEVALVKVDYDMPSGGYG-NWSGDSVQGSNPGGVFTMWND 302 >ref|XP_006467192.1| PREDICTED: AP2-like ethylene-responsive transcription factor PLT2-like [Citrus sinensis] Length = 551 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 +AEEL +VKVDYDM S Y T WSG+SVQG+N FTMWND Sbjct: 512 AAEELGMVKVDYDMPSGGY-TNWSGDSVQGTNAGFFTMWND 551 >ref|XP_006446069.1| hypothetical protein CICLE_v10014809mg [Citrus clementina] gi|557548680|gb|ESR59309.1| hypothetical protein CICLE_v10014809mg [Citrus clementina] Length = 548 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 2 SAEELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 +AEEL +VKVDYDM S Y T WSG+SVQG+N FTMWND Sbjct: 509 AAEELGMVKVDYDMPSGGY-TNWSGDSVQGTNAGFFTMWND 548 >emb|CBI16410.3| unnamed protein product [Vitis vinifera] Length = 535 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 11 ELALVKVDYDMASTTYSTGWSGESVQGSNPSVFTMWND 124 EL L+KVDYDM + Y + WSG+SVQG N VFTMWND Sbjct: 499 ELPLIKVDYDMPAAGYGS-WSGDSVQGQNAGVFTMWND 535