BLASTX nr result
ID: Rauwolfia21_contig00039378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00039378 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006663898.1| PREDICTED: subtilisin inhibitor 1-like [Oryz... 58 1e-06 ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus co... 56 6e-06 ref|XP_006429140.1| hypothetical protein CICLE_v10013177mg [Citr... 55 7e-06 >ref|XP_006663898.1| PREDICTED: subtilisin inhibitor 1-like [Oryza brachyantha] Length = 87 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/67 (46%), Positives = 40/67 (59%) Frame = -3 Query: 373 PALRYLL*TWPELVGFSGEAAAEMIKAEMPTADIQFIVGPPWAFQQDYRSYRVRIAVDSS 194 PA + +WPELVG S EAA E I+ E P D+Q + G + DY + RVR+ VDS Sbjct: 19 PAAAAVKDSWPELVGVSSEAAKEKIREERPEVDVQVVPGDAFV-TMDYNAGRVRVFVDSD 77 Query: 193 NKVALPP 173 +KVA P Sbjct: 78 DKVARAP 84 >ref|XP_002532999.1| subtilisin inhibitor 1, putative [Ricinus communis] gi|223527228|gb|EEF29391.1| subtilisin inhibitor 1, putative [Ricinus communis] Length = 103 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/59 (47%), Positives = 36/59 (61%) Frame = -3 Query: 349 TWPELVGFSGEAAAEMIKAEMPTADIQFIVGPPWAFQQDYRSYRVRIAVDSSNKVALPP 173 TWP+LVG E A IK +MP ++Q +V P D+R RVR+ +DSS KVA PP Sbjct: 43 TWPDLVGVMAEEAERKIKEDMPGVEVQ-VVQPNCFITMDFREGRVRLFIDSSGKVARPP 100 >ref|XP_006429140.1| hypothetical protein CICLE_v10013177mg [Citrus clementina] gi|567873103|ref|XP_006429141.1| hypothetical protein CICLE_v10013177mg [Citrus clementina] gi|568854491|ref|XP_006480859.1| PREDICTED: subtilisin inhibitor 1-like [Citrus sinensis] gi|557531197|gb|ESR42380.1| hypothetical protein CICLE_v10013177mg [Citrus clementina] gi|557531198|gb|ESR42381.1| hypothetical protein CICLE_v10013177mg [Citrus clementina] Length = 105 Score = 55.5 bits (132), Expect = 7e-06 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -3 Query: 349 TWPELVGFSGEAAAEMIKAEMPTADIQFIVGPPWAF-QQDYRSYRVRIAVDSSNKVALPP 173 TWP LVG + E A + IK E P A +Q + PP +F D+R RVR+ VDSS KV PP Sbjct: 45 TWPGLVGLTAEEAEKKIKEERPGAQVQVV--PPNSFVTMDFRHNRVRLYVDSSGKVERPP 102 Query: 172 S 170 S Sbjct: 103 S 103