BLASTX nr result
ID: Rauwolfia21_contig00039342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00039342 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 78 2e-14 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 77.8 bits (190), Expect(2) = 2e-14 Identities = 37/43 (86%), Positives = 37/43 (86%) Frame = -3 Query: 242 HRGVVARVSPPGILHLAFMISTFNCAPETRSKHAHSVGFFHDM 114 H GVVARVS PGILHLAFMISTF CAPETRSKHA V FFHDM Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDM 795 Score = 26.2 bits (56), Expect(2) = 2e-14 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 277 GRRAPECASDWHIG 236 GRR P CASD H+G Sbjct: 742 GRRGPGCASDRHMG 755