BLASTX nr result
ID: Rauwolfia21_contig00036369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00036369 (1254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535170.1| conserved hypothetical protein [Ricinus comm... 74 2e-10 >ref|XP_002535170.1| conserved hypothetical protein [Ricinus communis] gi|255598352|ref|XP_002536987.1| conserved hypothetical protein [Ricinus communis] gi|223517891|gb|EEF25396.1| conserved hypothetical protein [Ricinus communis] gi|223523842|gb|EEF27215.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 73.6 bits (179), Expect = 2e-10 Identities = 39/50 (78%), Positives = 41/50 (82%) Frame = +1 Query: 1021 VSQRQQKAGRDLRLYSKSMSEFASAKIIIDAGSLDNIASTEMVDQLGLQP 1170 VSQRQQK G D RLYS+SMSE ASAK +IDAGS DNI T MVDQLGLQP Sbjct: 72 VSQRQQKGGGDGRLYSESMSELASAKRLIDAGSSDNIVYTGMVDQLGLQP 121