BLASTX nr result
ID: Rauwolfia21_contig00036311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00036311 (219 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054512.1| cytochrome f [Nicotiana tabacum] gi|78102549|re... 108 6e-22 ref|NP_783245.1| cytochrome f [Atropa belladonna] gi|27734235|sp... 108 6e-22 ref|YP_008964879.1| cytochrome f (chloroplast) [Schwalbea americ... 108 6e-22 ref|YP_008815950.1| cytochrome f (chloroplast) [Lindenbergia phi... 108 6e-22 gb|AGW98983.1| cytochrome f (chloroplast) [Turbina corymbosa] 108 6e-22 gb|AGW98473.1| cytochrome f (chloroplast) [Ipomoea minutiflora] 108 6e-22 gb|AGW98218.1| cytochrome f (chloroplast) [Ipomoea tricolor] 108 6e-22 gb|AGW98133.1| cytochrome f (chloroplast) [Ipomoea ternifolia] 108 6e-22 gb|AGW97964.1| cytochrome f (chloroplast) [Ipomoea setosa] 108 6e-22 gb|AGW96944.1| cytochrome f (chloroplast) [Ipomoea cairica] gi|5... 108 6e-22 gb|AGW96774.1| cytochrome f (chloroplast) [Ipomoea amnicola] gi|... 108 6e-22 gb|AGW96689.1| cytochrome f (chloroplast) [Argyreia nervosa] 108 6e-22 gb|AGW96350.1| cytochrome f (chloroplast) [Ipomoea batatas] gi|5... 108 6e-22 gb|AGW04299.1| cytochrome f [Secamone afzelii] 108 6e-22 ref|YP_008592501.1| cytochrome f (chloroplast) [Andrographis pan... 108 6e-22 ref|YP_008081278.1| cytochrome f (chloroplast) [Catharanthus ros... 108 6e-22 gb|AGJ51268.1| cytochrome f (chloroplast) [Solanum carolinense] 108 6e-22 ref|YP_538861.1| cytochrome f [Solanum bulbocastanum] gi|1087731... 108 6e-22 gb|AFU96161.1| PetA, partial (chloroplast) [Galearia maingayi] 108 6e-22 ref|YP_006503804.1| component of cytochrome b6/f complex (chloro... 108 6e-22 >ref|NP_054512.1| cytochrome f [Nicotiana tabacum] gi|78102549|ref|YP_358690.1| cytochrome f [Nicotiana sylvestris] gi|351653893|ref|YP_004891618.1| petA gene product (chloroplast) [Nicotiana undulata] gi|118053|sp|P06449.1|CYF_TOBAC RecName: Full=Apocytochrome f; Flags: Precursor gi|122239305|sp|Q3C1I8.1|CYF_NICSY RecName: Full=Apocytochrome f; Flags: Precursor gi|11845|emb|CAA77365.1| cytochrome f [Nicotiana tabacum] gi|77799576|dbj|BAE46665.1| cytochrome f [Nicotiana sylvestris] gi|347453919|gb|AEO95577.1| cytochrome f (chloroplast) [Nicotiana undulata] gi|347454030|gb|AEO95687.1| cytochrome f [synthetic construct] gi|225213|prf||1211235AU cytochrome f Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >ref|NP_783245.1| cytochrome f [Atropa belladonna] gi|27734235|sp|Q8S8W4.1|CYF_ATRBE RecName: Full=Apocytochrome f; Flags: Precursor gi|20068344|emb|CAC88057.1| cytochrome f [Atropa belladonna] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >ref|YP_008964879.1| cytochrome f (chloroplast) [Schwalbea americana] gi|560176712|emb|CDJ38636.1| cytochrome f (chloroplast) [Schwalbea americana] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >ref|YP_008815950.1| cytochrome f (chloroplast) [Lindenbergia philippensis] gi|557136876|emb|CDI43931.1| cytochrome f (chloroplast) [Lindenbergia philippensis] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW98983.1| cytochrome f (chloroplast) [Turbina corymbosa] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW98473.1| cytochrome f (chloroplast) [Ipomoea minutiflora] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW98218.1| cytochrome f (chloroplast) [Ipomoea tricolor] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW98133.1| cytochrome f (chloroplast) [Ipomoea ternifolia] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW97964.1| cytochrome f (chloroplast) [Ipomoea setosa] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW96944.1| cytochrome f (chloroplast) [Ipomoea cairica] gi|546353130|gb|AGW97029.1| cytochrome f (chloroplast) [Ipomoea diamantinensis] gi|546353216|gb|AGW97114.1| cytochrome f (chloroplast) [Ipomoea dumetorum] gi|546353302|gb|AGW97199.1| cytochrome f (chloroplast) [Ipomoea eriocarpa] gi|546353388|gb|AGW97284.1| cytochrome f (chloroplast) [Ipomoea hederifolia] gi|546353474|gb|AGW97369.1| cytochrome f (chloroplast) [Ipomoea involucrata] gi|546353732|gb|AGW97624.1| cytochrome f (chloroplast) [Ipomoea orizabensis] gi|546353818|gb|AGW97709.1| cytochrome f (chloroplast) [Ipomoea pedicellaris] gi|546354677|gb|AGW98558.1| cytochrome f (chloroplast) [Ipomoea obscura] gi|546354763|gb|AGW98643.1| cytochrome f (chloroplast) [Ipomoea pes-tigridis] gi|546354849|gb|AGW98728.1| cytochrome f (chloroplast) [Merremia quinquefolia] gi|546354935|gb|AGW98813.1| cytochrome f (chloroplast) [Operculina macrocarpa] gi|546355021|gb|AGW98898.1| cytochrome f (chloroplast) [Stictocardia macalusoi] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW96774.1| cytochrome f (chloroplast) [Ipomoea amnicola] gi|546352958|gb|AGW96859.1| cytochrome f (chloroplast) [Ipomoea argillicola] gi|546353560|gb|AGW97454.1| cytochrome f (chloroplast) [Ipomoea murucoides] gi|546353904|gb|AGW97794.1| cytochrome f (chloroplast) [Ipomoea pes-caprae] gi|546353990|gb|AGW97879.1| cytochrome f (chloroplast) [Ipomoea polpha] gi|546354161|gb|AGW98048.1| cytochrome f (chloroplast) [Ipomoea splendor-sylvae] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW96689.1| cytochrome f (chloroplast) [Argyreia nervosa] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW96350.1| cytochrome f (chloroplast) [Ipomoea batatas] gi|546352529|gb|AGW96435.1| cytochrome f (chloroplast) [Ipomoea batatas] gi|546352615|gb|AGW96520.1| cytochrome f (chloroplast) [Ipomoea batatas] gi|546352700|gb|AGW96604.1| cytochrome f (chloroplast) [Ipomoea trifida] gi|546354419|gb|AGW98303.1| cytochrome f (chloroplast) [Ipomoea trifida] gi|546354505|gb|AGW98388.1| cytochrome f (chloroplast) [Ipomoea cordatotriloba] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGW04299.1| cytochrome f [Secamone afzelii] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >ref|YP_008592501.1| cytochrome f (chloroplast) [Andrographis paniculata] gi|532164849|gb|AGT79859.1| cytochrome f (chloroplast) [Andrographis paniculata] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >ref|YP_008081278.1| cytochrome f (chloroplast) [Catharanthus roseus] gi|474452089|gb|AGI51157.1| cytochrome f (chloroplast) [Catharanthus roseus] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AGJ51268.1| cytochrome f (chloroplast) [Solanum carolinense] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >ref|YP_538861.1| cytochrome f [Solanum bulbocastanum] gi|108773143|ref|YP_635652.1| cytochrome f [Solanum tuberosum] gi|544163626|ref|YP_008563101.1| cytochrome f (chloroplast) [Solanum lycopersicum] gi|544170684|ref|AP_004941.1| cytochrome f (chloroplast) [Solanum lycopersicum] gi|460365365|ref|XP_004228573.1| PREDICTED: apocytochrome f-like [Solanum lycopersicum] gi|122232536|sp|Q2MIH4.1|CYF_SOLBU RecName: Full=Apocytochrome f; Flags: Precursor gi|122248445|sp|Q2MI87.1|CYF_SOLLC RecName: Full=Apocytochrome f; Flags: Precursor gi|122248894|sp|Q2VEG4.1|CYF_SOLTU RecName: Full=Apocytochrome f; Flags: Precursor gi|82754640|gb|ABB90054.1| cytochrome f [Solanum tuberosum] gi|84371908|gb|ABC56226.1| cytochrome f [Solanum bulbocastanum] gi|84371996|gb|ABC56313.1| cytochrome f (chloroplast) [Solanum lycopersicum] gi|88656817|gb|ABD47070.1| cytochrome f [Solanum tuberosum] gi|89241684|emb|CAJ32406.1| cytochrome f [Solanum lycopersicum] gi|329124595|gb|AEB72152.1| cytochrome f (chloroplast) [Solanum tuberosum] gi|329124682|gb|AEB72238.1| cytochrome f (chloroplast) [Solanum tuberosum] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320 >gb|AFU96161.1| PetA, partial (chloroplast) [Galearia maingayi] Length = 325 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 271 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 325 >ref|YP_006503804.1| component of cytochrome b6/f complex (chloroplast) [Datura stramonium] gi|350996439|gb|AEQ36951.1| component of cytochrome b6/f complex (chloroplast) [Datura stramonium] gi|350996525|gb|AEQ37036.1| component of cytochrome b6/f complex [Datura stramonium] Length = 320 Score = 108 bits (271), Expect = 6e-22 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = +3 Query: 3 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 167 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF Sbjct: 266 PNVGGFGQGDAEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF 320