BLASTX nr result
ID: Rauwolfia21_contig00034991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00034991 (529 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004299101.1| PREDICTED: organ-specific protein S2-like [F... 58 2e-06 gb|EXB63590.1| hypothetical protein L484_026929 [Morus notabilis] 57 3e-06 >ref|XP_004299101.1| PREDICTED: organ-specific protein S2-like [Fragaria vesca subsp. vesca] Length = 112 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/67 (44%), Positives = 39/67 (58%) Frame = -1 Query: 406 GDYWKRVMHDQPMPKAIADLIGEDSTSHRYSLKHGQKLPKSDTKTLRMERFATNFDTMPN 227 GDYWK VM+DQPMP+A+ DL SH+ + +P + RF +FD PN Sbjct: 28 GDYWKSVMNDQPMPEALKDLF-----SHQ-----DEDVPSFSASKNKDHRFVRDFDIRPN 77 Query: 226 VIIYHSS 206 VIIYHS+ Sbjct: 78 VIIYHSA 84 >gb|EXB63590.1| hypothetical protein L484_026929 [Morus notabilis] Length = 106 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/66 (42%), Positives = 36/66 (54%) Frame = -1 Query: 406 GDYWKRVMHDQPMPKAIADLIGEDSTSHRYSLKHGQKLPKSDTKTLRMERFATNFDTMPN 227 G+YW +M DQP+P+AI DL + Q LP T + +RF +FD PN Sbjct: 27 GEYWNSIMKDQPIPEAIRDLF------------YDQDLPSDLTGPTKHDRFVRDFDVQPN 74 Query: 226 VIIYHS 209 VIIYHS Sbjct: 75 VIIYHS 80