BLASTX nr result
ID: Rauwolfia21_contig00034689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00034689 (479 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC11333.1| Putative tRNA pseudouridine synthase [Morus notab... 86 7e-15 ref|XP_002319961.2| hypothetical protein POPTR_0013s15030g [Popu... 83 4e-14 gb|EMJ08575.1| hypothetical protein PRUPE_ppa004352mg [Prunus pe... 83 4e-14 ref|XP_002517734.1| pseudouridylate synthase, putative [Ricinus ... 83 4e-14 gb|EOY34659.1| Pseudouridine synthase family protein [Theobroma ... 81 2e-13 gb|ESW14066.1| hypothetical protein PHAVU_008G250200g [Phaseolus... 80 2e-13 ref|XP_002881100.1| tRNA pseudouridine synthase family protein [... 80 3e-13 emb|CBI15850.3| unnamed protein product [Vitis vinifera] 79 5e-13 ref|XP_002276856.1| PREDICTED: putative tRNA pseudouridine synth... 79 5e-13 emb|CAN68579.1| hypothetical protein VITISV_034891 [Vitis vinifera] 79 5e-13 ref|XP_006294040.1| hypothetical protein CARUB_v10023036mg [Caps... 79 6e-13 ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synth... 79 6e-13 ref|XP_006468147.1| PREDICTED: putative tRNA pseudouridine synth... 78 1e-12 ref|XP_006468144.1| PREDICTED: putative tRNA pseudouridine synth... 78 1e-12 ref|XP_006431978.1| hypothetical protein CICLE_v100038302mg, par... 78 1e-12 ref|XP_004490688.1| PREDICTED: putative tRNA pseudouridine synth... 78 1e-12 ref|XP_003557058.1| PREDICTED: putative tRNA pseudouridine synth... 78 1e-12 ref|XP_004296032.1| PREDICTED: putative tRNA pseudouridine synth... 78 1e-12 ref|XP_004490755.1| PREDICTED: putative tRNA pseudouridine synth... 76 4e-12 ref|NP_180591.1| putative tRNA pseudouridine synthase [Arabidops... 76 4e-12 >gb|EXC11333.1| Putative tRNA pseudouridine synthase [Morus notabilis] Length = 481 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/49 (73%), Positives = 45/49 (91%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 +SFD RRECN+RKYSYLLPA+V+GIK NF++++IDFH+SDFN ILN FE Sbjct: 178 KSFDPRRECNLRKYSYLLPADVVGIKSNFTTDKIDFHISDFNEILNTFE 226 >ref|XP_002319961.2| hypothetical protein POPTR_0013s15030g [Populus trichocarpa] gi|550325882|gb|EEE95884.2| hypothetical protein POPTR_0013s15030g [Populus trichocarpa] Length = 505 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 +SFD RREC+IRKYSYLLPAEVIGIK +FS EID H+SDFN ILNAFE Sbjct: 190 KSFDPRRECDIRKYSYLLPAEVIGIKSHFSMAEIDDHISDFNNILNAFE 238 >gb|EMJ08575.1| hypothetical protein PRUPE_ppa004352mg [Prunus persica] Length = 515 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFD R+ECN+R YSYLLPA+VIGIK +FSS EID+H+SDFN ILN FE Sbjct: 176 RSFDPRKECNLRMYSYLLPADVIGIKSHFSSAEIDYHISDFNSILNCFE 224 >ref|XP_002517734.1| pseudouridylate synthase, putative [Ricinus communis] gi|223543132|gb|EEF44666.1| pseudouridylate synthase, putative [Ricinus communis] Length = 377 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 +SFD RRECN+RKYSYLLPAE+IGIK +F+S EID H+SDFN ILNAFE Sbjct: 168 KSFDPRRECNLRKYSYLLPAEIIGIKGHFTSAEIDNHISDFNDILNAFE 216 >gb|EOY34659.1| Pseudouridine synthase family protein [Theobroma cacao] Length = 507 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 +SFD RRECN+RKYSYLLPAE+IGIK +FS EI+ H+SDFN ILN FE Sbjct: 171 KSFDPRRECNLRKYSYLLPAEIIGIKSHFSEAEINHHISDFNSILNCFE 219 >gb|ESW14066.1| hypothetical protein PHAVU_008G250200g [Phaseolus vulgaris] Length = 512 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 + FD RRECN+RKYSYLLPA++IGI+ +FS +EIDFH+S+FN ILN FE Sbjct: 184 KRFDPRRECNLRKYSYLLPADIIGIQSHFSKDEIDFHISEFNSILNVFE 232 >ref|XP_002881100.1| tRNA pseudouridine synthase family protein [Arabidopsis lyrata subsp. lyrata] gi|297326939|gb|EFH57359.1| tRNA pseudouridine synthase family protein [Arabidopsis lyrata subsp. lyrata] Length = 507 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 R FD RREC +RKYSYLLP +VIGIK +F+S+EID+H++DFN+ILN FE Sbjct: 177 RRFDPRRECTLRKYSYLLPVDVIGIKNSFTSDEIDYHITDFNKILNEFE 225 >emb|CBI15850.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFDARREC++R+YSYLLPAE+IGIK N S+ EID H+++FN ILN FE Sbjct: 177 RSFDARRECDLRRYSYLLPAEIIGIKSNSSASEIDHHIAEFNDILNTFE 225 >ref|XP_002276856.1| PREDICTED: putative tRNA pseudouridine synthase-like [Vitis vinifera] Length = 564 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFDARREC++R+YSYLLPAE+IGIK N S+ EID H+++FN ILN FE Sbjct: 177 RSFDARRECDLRRYSYLLPAEIIGIKSNSSASEIDHHIAEFNDILNTFE 225 >emb|CAN68579.1| hypothetical protein VITISV_034891 [Vitis vinifera] Length = 602 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFDARREC++R+YSYLLPAE+IGIK N S+ EID H+++FN ILN FE Sbjct: 177 RSFDARRECDLRRYSYLLPAEIIGIKSNSSASEIDHHIAEFNDILNTFE 225 >ref|XP_006294040.1| hypothetical protein CARUB_v10023036mg [Capsella rubella] gi|482562748|gb|EOA26938.1| hypothetical protein CARUB_v10023036mg [Capsella rubella] Length = 508 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 R FD RREC +RKYSYLLP +VIGIK NF+S+EID+H++DFN IL FE Sbjct: 178 RRFDPRRECTLRKYSYLLPVDVIGIKSNFTSDEIDYHITDFNEILKEFE 226 >ref|XP_003518334.1| PREDICTED: putative tRNA pseudouridine synthase-like [Glycine max] Length = 516 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 + FD RRECN+RKYSYLLPA +IGI+ +FS +EIDFH+S+FN ILN FE Sbjct: 189 KRFDPRRECNLRKYSYLLPAGIIGIQSHFSQDEIDFHISEFNSILNVFE 237 >ref|XP_006468147.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X4 [Citrus sinensis] Length = 539 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFD RRECN+RKYSYLLPAEVIGI ++ EID H+SDFN ILN FE Sbjct: 192 RSFDPRRECNLRKYSYLLPAEVIGINSQLTAAEIDSHISDFNAILNEFE 240 >ref|XP_006468144.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X1 [Citrus sinensis] gi|568827612|ref|XP_006468145.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X2 [Citrus sinensis] gi|568827614|ref|XP_006468146.1| PREDICTED: putative tRNA pseudouridine synthase-like isoform X3 [Citrus sinensis] Length = 605 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFD RRECN+RKYSYLLPAEVIGI ++ EID H+SDFN ILN FE Sbjct: 258 RSFDPRRECNLRKYSYLLPAEVIGINSQLTAAEIDSHISDFNAILNEFE 306 >ref|XP_006431978.1| hypothetical protein CICLE_v100038302mg, partial [Citrus clementina] gi|557534100|gb|ESR45218.1| hypothetical protein CICLE_v100038302mg, partial [Citrus clementina] Length = 380 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFD RRECN+RKYSYLLPAEVIGI ++ EID H+SDFN ILN FE Sbjct: 17 RSFDPRRECNLRKYSYLLPAEVIGINSQLTAAEIDSHISDFNAILNEFE 65 >ref|XP_004490688.1| PREDICTED: putative tRNA pseudouridine synthase-like [Cicer arietinum] Length = 483 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 + FD RRECN+RKYSYLLPA++IGI+ +FS +EIDFH+S+FN IL FE Sbjct: 165 KRFDPRRECNLRKYSYLLPADIIGIQSHFSEDEIDFHISEFNSILGVFE 213 >ref|XP_003557058.1| PREDICTED: putative tRNA pseudouridine synthase-like [Glycine max] Length = 518 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 + FD RRECN+RKYSYLLPA++IGI+ +FS +EIDFH+ +FN ILN FE Sbjct: 188 KRFDPRRECNLRKYSYLLPADIIGIQSHFSQDEIDFHILEFNSILNVFE 236 >ref|XP_004296032.1| PREDICTED: putative tRNA pseudouridine synthase-like [Fragaria vesca subsp. vesca] Length = 509 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFD R+ECN+R YSYLLPA+VIGIK +FS+ EI+ H++DFN ILNAFE Sbjct: 174 RSFDPRKECNLRMYSYLLPADVIGIKSHFSAAEIEDHIADFNDILNAFE 222 >ref|XP_004490755.1| PREDICTED: putative tRNA pseudouridine synthase-like, partial [Cicer arietinum] Length = 474 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 RSFD R+ECN+RKYSYLLPAE+IGI+ S++EID+HLS+FN IL FE Sbjct: 143 RSFDPRKECNLRKYSYLLPAEIIGIQSYSSNDEIDYHLSEFNDILKEFE 191 >ref|NP_180591.1| putative tRNA pseudouridine synthase [Arabidopsis thaliana] gi|3914486|sp|O22928.1|PUSH_ARATH RecName: Full=Putative tRNA pseudouridine synthase; AltName: Full=tRNA pseudouridylate synthase; AltName: Full=tRNA-uridine isomerase gi|2347206|gb|AAC16945.1| putative pseudouridine synthase [Arabidopsis thaliana] gi|330253276|gb|AEC08370.1| putative tRNA pseudouridine synthase [Arabidopsis thaliana] Length = 510 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/49 (65%), Positives = 41/49 (83%) Frame = -1 Query: 479 RSFDARRECNIRKYSYLLPAEVIGIKKNFSSEEIDFHLSDFNRILNAFE 333 R FD RREC +RKYSYLLP +V+GIK +F+S+EID+H++DFN IL FE Sbjct: 177 RRFDPRRECTLRKYSYLLPVDVLGIKNSFTSDEIDYHITDFNEILKEFE 225