BLASTX nr result
ID: Rauwolfia21_contig00034646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00034646 (241 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006357716.1| PREDICTED: carboxylesterase 1-like [Solanum ... 56 6e-06 >ref|XP_006357716.1| PREDICTED: carboxylesterase 1-like [Solanum tuberosum] Length = 332 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -2 Query: 168 ADSAPIDPNVDPYGSMGFVKNPDGSLTRFPLPLPETPASEDPSNPFNLSKDIIIN 4 +++ PIDPNVDPYG +G V+N DGS+TR PL S D S+ +KDI IN Sbjct: 6 SETMPIDPNVDPYGCLGMVRNSDGSITRLQEPLVPVDTSNDLSH-LVFTKDISIN 59