BLASTX nr result
ID: Rauwolfia21_contig00033788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00033788 (420 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367245.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_004250470.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 >ref|XP_006367245.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic-like [Solanum tuberosum] Length = 944 Score = 70.5 bits (171), Expect = 2e-10 Identities = 47/97 (48%), Positives = 62/97 (63%), Gaps = 2/97 (2%) Frame = +2 Query: 77 IFSLSSTAHYSHAPPPPFSASVLAVKHHVTSATSISSLKYXXXXXXXXXXA-GPRRPTSH 253 IFSLSSTAHYS + PPPF+ S+LA KHH S+TSI SLK + RRPT++ Sbjct: 19 IFSLSSTAHYSPS-PPPFTTSILAGKHH-PSSTSILSLKSSSDYPEKPTTSTSLRRPTTN 76 Query: 254 KPLKASS-SDYSKYPGNPLKNLINSQTTPPVSAPPPN 361 KP ++ S ++ NPLK L+NS PP ++PPP+ Sbjct: 77 KPPDTTTHSQNLEFSKNPLKLLLNS---PPNTSPPPS 110 >ref|XP_004250470.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04810, chloroplastic-like [Solanum lycopersicum] Length = 932 Score = 59.3 bits (142), Expect = 5e-07 Identities = 38/95 (40%), Positives = 53/95 (55%), Gaps = 1/95 (1%) Frame = +2 Query: 77 IFSLSSTAHYSHAPPPPFSASVLAVKHHVTSATSISSLKYXXXXXXXXXXAGPRRPTSHK 256 IFSLSSTAHYS + PPPF+ S+LA KHH ++ + RRPT++K Sbjct: 5 IFSLSSTAHYSPS-PPPFATSILAGKHHPSTTCILFLKSSSDSPEKPTTSTSLRRPTTNK 63 Query: 257 PLKASS-SDYSKYPGNPLKNLINSQTTPPVSAPPP 358 P ++ S + NPLK L++S PP ++ PP Sbjct: 64 PPDITTHSQNLAFSKNPLKLLLSS---PPNTSSPP 95