BLASTX nr result
ID: Rauwolfia21_contig00033525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00033525 (477 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422815.1| hypothetical protein CICLE_v10030423mg [Citr... 71 1e-10 >ref|XP_006422815.1| hypothetical protein CICLE_v10030423mg [Citrus clementina] gi|557524749|gb|ESR36055.1| hypothetical protein CICLE_v10030423mg [Citrus clementina] Length = 73 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = -2 Query: 467 RMANLMVIFDGLRLFVSTIWDLQEMRFSAIFDDLSYIVITIFMVAVSCLEARVRRR 300 +MA + IF+GLRL VST+WDLQE+R++ +FDD+SYI TI M AVSC+ A +RRR Sbjct: 15 KMAIFLEIFNGLRLCVSTLWDLQEIRYATVFDDVSYIATTIIMAAVSCV-ASIRRR 69