BLASTX nr result
ID: Rauwolfia21_contig00032856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00032856 (243 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] 89 6e-16 >dbj|BAA11674.1| unnamed protein product [Nicotiana tabacum] Length = 1338 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/57 (68%), Positives = 49/57 (85%) Frame = +1 Query: 70 DDDQTQPLPSNTSSFHTRSGRVVQRSTRYSPHEYVMLTDGGEPESYEKVINDKHKEK 240 ++DQ QP N +HTRSGRVVQ+STRYSPHEYV+LTDGGEP+S+E+ I+D+HKEK Sbjct: 770 EEDQPQPPILNNPPYHTRSGRVVQQSTRYSPHEYVLLTDGGEPDSFEEAIDDEHKEK 826