BLASTX nr result
ID: Rauwolfia21_contig00032454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00032454 (773 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74537.1| hypothetical protein M569_00254, partial [Genlise... 40 5e-06 >gb|EPS74537.1| hypothetical protein M569_00254, partial [Genlisea aurea] Length = 89 Score = 39.7 bits (91), Expect(3) = 5e-06 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = +3 Query: 108 SFAFTASIVPIASYLMLRSKFSNGA 182 SFAF ASIVP AS LM+RS+F+NGA Sbjct: 1 SFAFKASIVPTASSLMIRSEFANGA 25 Score = 32.0 bits (71), Expect(3) = 5e-06 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 6/44 (13%) Frame = +1 Query: 181 LIMKFVLESIFSVFIGSQLLIFL------FCSISSIRRGF*LCY 294 ++++F ESIF VFIGS+LL FL ++S R F LCY Sbjct: 27 ILIEFNHESIFLVFIGSKLLFFLKDSLNRSSTLSVYIRVFMLCY 70 Score = 25.0 bits (53), Expect(3) = 5e-06 Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = +2 Query: 305 VLMLYYTA--FYEMTYKPYIL 361 V ML Y FYEMT +PYIL Sbjct: 65 VFMLCYIVLFFYEMTPRPYIL 85