BLASTX nr result
ID: Rauwolfia21_contig00032436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00032436 (706 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 57 4e-06 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gi|222861166|gb|EEE98708.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] Length = 64 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 107 MRIQRLRSWQRCSRYIQEQRTRLYIIWKCLMFLL 208 MR +LRSWQRCS+ I+EQRTRLYIIW+C + LL Sbjct: 27 MRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLL 60