BLASTX nr result
ID: Rauwolfia21_contig00032013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00032013 (822 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006576082.1| PREDICTED: uncharacterized protein LOC102659... 58 5e-06 >ref|XP_006576082.1| PREDICTED: uncharacterized protein LOC102659506 [Glycine max] Length = 964 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/77 (33%), Positives = 42/77 (54%) Frame = -2 Query: 272 REPHRDQGFRPIEPQTQEDLINLSSDDTEDVESWGHCLVGYFAGRFPRKVAVQELVQSWT 93 R P + G + P + ++++ +D E+WGH L+GY AGRFP K A+ + + W Sbjct: 143 RSPSKGFGMKFSPPPSDDEVLLEETDLQPLEEAWGHSLIGYVAGRFPGKKALLDCCKKWG 202 Query: 92 VSTKFFNHASRWLIVQF 42 V + H S WL+ +F Sbjct: 203 VKFSYSAHESGWLVFKF 219