BLASTX nr result
ID: Rauwolfia21_contig00031476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00031476 (236 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004242312.1| PREDICTED: outer envelope pore protein 16-4,... 60 2e-07 ref|XP_006352813.1| PREDICTED: outer envelope pore protein 16-4,... 59 9e-07 >ref|XP_004242312.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic-like [Solanum lycopersicum] Length = 128 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 98 PCSSIAVDAVLRIGTAGVMWGSCSGSYEANKL 3 PCSSIAVD+V+R+GTAG++WGSCSG Y+ANKL Sbjct: 10 PCSSIAVDSVIRMGTAGLIWGSCSGPYDANKL 41 >ref|XP_006352813.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic-like [Solanum tuberosum] Length = 128 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -1 Query: 98 PCSSIAVDAVLRIGTAGVMWGSCSGSYEANKL 3 PCSSIAVD+V+R+GTAG++WGSCSG Y+A+KL Sbjct: 10 PCSSIAVDSVIRMGTAGLIWGSCSGPYDASKL 41