BLASTX nr result
ID: Rauwolfia21_contig00029997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00029997 (1126 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37993.1| Two pore calcium channel protein 1A [Morus notabi... 74 8e-11 gb|EXB72966.1| Two pore calcium channel protein 1A [Morus notabi... 70 1e-09 gb|EXB37988.1| Two pore calcium channel protein 1 [Morus notabilis] 70 1e-09 ref|XP_006491623.1| PREDICTED: two pore calcium channel protein ... 70 1e-09 ref|XP_006447309.1| hypothetical protein CICLE_v10014388mg [Citr... 70 1e-09 ref|XP_006447308.1| hypothetical protein CICLE_v10014388mg [Citr... 70 1e-09 ref|XP_006447307.1| hypothetical protein CICLE_v10014388mg [Citr... 70 1e-09 ref|XP_006447306.1| hypothetical protein CICLE_v10014388mg [Citr... 70 1e-09 gb|EOX99429.1| Two-pore channel 1 [Theobroma cacao] 70 1e-09 ref|XP_002517914.1| Voltage-dependent L-type calcium channel, pu... 70 2e-09 sp|Q75VR0.1|TPC1B_TOBAC RecName: Full=Two pore calcium channel p... 70 2e-09 sp|Q75VR1.1|TCP1A_TOBAC RecName: Full=Two pore calcium channel p... 70 2e-09 ref|XP_006287141.1| hypothetical protein CARUB_v10000313mg [Caps... 69 3e-09 ref|NP_567258.1| two pore calcium channel protein 1 [Arabidopsis... 69 3e-09 gb|AAD11598.1| putative calcium channel [Arabidopsis thaliana] g... 69 3e-09 ref|XP_002874860.1| two-pore channel 1 [Arabidopsis lyrata subsp... 69 3e-09 ref|XP_004303095.1| PREDICTED: two pore calcium channel protein ... 68 6e-09 emb|CBI21853.3| unnamed protein product [Vitis vinifera] 68 6e-09 ref|XP_006859047.1| hypothetical protein AMTR_s00068p00186370 [A... 68 8e-09 ref|XP_004171256.1| PREDICTED: two pore calcium channel protein ... 68 8e-09 >gb|EXB37993.1| Two pore calcium channel protein 1A [Morus notabilis] Length = 296 Score = 74.3 bits (181), Expect = 8e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQVIEFLM 1018 YLL NFNDYPNGMVTLFNLLVMGNWQVWMQVI F++ Sbjct: 224 YLLLNFNDYPNGMVTLFNLLVMGNWQVWMQVIAFVL 259 >gb|EXB72966.1| Two pore calcium channel protein 1A [Morus notabilis] Length = 429 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 315 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 344 >gb|EXB37988.1| Two pore calcium channel protein 1 [Morus notabilis] Length = 717 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 585 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 614 >ref|XP_006491623.1| PREDICTED: two pore calcium channel protein 1-like isoform X2 [Citrus sinensis] Length = 714 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 592 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 621 >ref|XP_006447309.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] gi|557549920|gb|ESR60549.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] Length = 697 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 575 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 604 >ref|XP_006447308.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] gi|557549919|gb|ESR60548.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] Length = 722 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 600 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 629 >ref|XP_006447307.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] gi|557549918|gb|ESR60547.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] Length = 691 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 569 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 598 >ref|XP_006447306.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] gi|568877173|ref|XP_006491622.1| PREDICTED: two pore calcium channel protein 1-like isoform X1 [Citrus sinensis] gi|557549917|gb|ESR60546.1| hypothetical protein CICLE_v10014388mg [Citrus clementina] Length = 745 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 623 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 652 >gb|EOX99429.1| Two-pore channel 1 [Theobroma cacao] Length = 737 Score = 70.5 bits (171), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ Sbjct: 609 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 638 >ref|XP_002517914.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] gi|223542896|gb|EEF44432.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] Length = 743 Score = 70.1 bits (170), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQ+WMQ Sbjct: 617 YLLFNFNDYPNGMVTLFNLLVMGNWQIWMQ 646 >sp|Q75VR0.1|TPC1B_TOBAC RecName: Full=Two pore calcium channel protein 1B; AltName: Full=Voltage-dependent calcium channel protein TPC1B; Short=NtTPC1B gi|46275794|dbj|BAD15100.1| two-pore calcium channel [Nicotiana tabacum] Length = 735 Score = 69.7 bits (169), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFN+LVMGNWQVWMQ Sbjct: 611 YLLFNFNDYPNGMVTLFNILVMGNWQVWMQ 640 >sp|Q75VR1.1|TCP1A_TOBAC RecName: Full=Two pore calcium channel protein 1A; AltName: Full=Voltage-dependent calcium channel protein TPC1A; Short=NtTPC1A gi|46275792|dbj|BAD15099.1| two-pore calcium channel [Nicotiana tabacum] Length = 735 Score = 69.7 bits (169), Expect = 2e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFN+LVMGNWQVWMQ Sbjct: 611 YLLFNFNDYPNGMVTLFNILVMGNWQVWMQ 640 >ref|XP_006287141.1| hypothetical protein CARUB_v10000313mg [Capsella rubella] gi|482555847|gb|EOA20039.1| hypothetical protein CARUB_v10000313mg [Capsella rubella] Length = 732 Score = 69.3 bits (168), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWM+ Sbjct: 607 YLLFNFNDYPNGMVTLFNLLVMGNWQVWME 636 >ref|NP_567258.1| two pore calcium channel protein 1 [Arabidopsis thaliana] gi|75166464|sp|Q94KI8.1|TPC1_ARATH RecName: Full=Two pore calcium channel protein 1; AltName: Full=Calcium channel protein 1; Short=AtCCH1; AltName: Full=Fatty acid oxygenation up-regulated protein 2; AltName: Full=Voltage-dependent calcium channel protein TPC1; Short=AtTPC1 gi|13786069|gb|AAK39554.1|AF360372_1 putative calcium channel [Arabidopsis thaliana] gi|222422931|dbj|BAH19452.1| AT4G03560 [Arabidopsis thaliana] gi|332656937|gb|AEE82337.1| two pore calcium channel protein 1 [Arabidopsis thaliana] Length = 733 Score = 69.3 bits (168), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWM+ Sbjct: 608 YLLFNFNDYPNGMVTLFNLLVMGNWQVWME 637 >gb|AAD11598.1| putative calcium channel [Arabidopsis thaliana] gi|4263043|gb|AAD15312.1| putative calcium channel [Arabidopsis thaliana] gi|7270679|emb|CAB77841.1| putative calcium channel [Arabidopsis thaliana] Length = 724 Score = 69.3 bits (168), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWM+ Sbjct: 599 YLLFNFNDYPNGMVTLFNLLVMGNWQVWME 628 >ref|XP_002874860.1| two-pore channel 1 [Arabidopsis lyrata subsp. lyrata] gi|297320697|gb|EFH51119.1| two-pore channel 1 [Arabidopsis lyrata subsp. lyrata] Length = 732 Score = 69.3 bits (168), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQVWM+ Sbjct: 607 YLLFNFNDYPNGMVTLFNLLVMGNWQVWME 636 >ref|XP_004303095.1| PREDICTED: two pore calcium channel protein 1-like [Fragaria vesca subsp. vesca] Length = 737 Score = 68.2 bits (165), Expect = 6e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLV GNWQVWMQ Sbjct: 612 YLLFNFNDYPNGMVTLFNLLVTGNWQVWMQ 641 >emb|CBI21853.3| unnamed protein product [Vitis vinifera] Length = 732 Score = 68.2 bits (165), Expect = 6e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVM NWQVWMQ Sbjct: 612 YLLFNFNDYPNGMVTLFNLLVMNNWQVWMQ 641 >ref|XP_006859047.1| hypothetical protein AMTR_s00068p00186370 [Amborella trichopoda] gi|548863159|gb|ERN20514.1| hypothetical protein AMTR_s00068p00186370 [Amborella trichopoda] Length = 196 Score = 67.8 bits (164), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQ WMQ Sbjct: 71 YLLFNFNDYPNGMVTLFNLLVMGNWQGWMQ 100 >ref|XP_004171256.1| PREDICTED: two pore calcium channel protein 1B-like [Cucumis sativus] Length = 194 Score = 67.8 bits (164), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 1125 YLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 1036 YLLFNFNDYPNGMVTLFNLLVMGNWQ WMQ Sbjct: 71 YLLFNFNDYPNGMVTLFNLLVMGNWQDWMQ 100