BLASTX nr result
ID: Rauwolfia21_contig00029699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00029699 (286 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284212.1| PREDICTED: germin-like protein subfamily 1 m... 47 4e-06 >ref|XP_002284212.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Vitis vinifera] Length = 225 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 21/39 (53%), Positives = 27/39 (69%) Frame = -1 Query: 130 KICKNPKLVTTEDFYLSAGFHTPGNTSGPAGTALNMVDV 14 K CK+PKL +DF+ S G H PGNTS P G+A+ V+V Sbjct: 48 KFCKDPKLAMADDFFFS-GLHIPGNTSNPVGSAVTPVNV 85 Score = 28.9 bits (63), Expect(2) = 4e-06 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 221 HFLTILAIFAFASPLIIAYDPSP 153 H L +A A AS L AYDPSP Sbjct: 6 HLLVTIAFMALASSLSSAYDPSP 28