BLASTX nr result
ID: Rauwolfia21_contig00025983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00025983 (534 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-li... 57 3e-06 ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2-li... 57 3e-06 >ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-like [Solanum tuberosum] Length = 241 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 5/37 (13%) Frame = +1 Query: 142 CKLA-----AKEVADLWMEYEENTSLEAKVVKDFDKV 237 CKL AKE++DLWMEYEEN+SLEAKVVKDFDKV Sbjct: 157 CKLLGGGSRAKEISDLWMEYEENSSLEAKVVKDFDKV 193 >ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2-like [Solanum lycopersicum] Length = 242 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 5/37 (13%) Frame = +1 Query: 142 CKLA-----AKEVADLWMEYEENTSLEAKVVKDFDKV 237 CKL AKE++DLWMEYEEN+SLEAKVVKDFDKV Sbjct: 158 CKLLGGGSRAKEISDLWMEYEENSSLEAKVVKDFDKV 194