BLASTX nr result
ID: Rauwolfia21_contig00025942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00025942 (258 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173443.1| hypothetical protein NitaMp105 [Nicotiana tabac... 62 8e-08 ref|XP_002535856.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|YP_173443.1| hypothetical protein NitaMp105 [Nicotiana tabacum] gi|56806607|dbj|BAD83508.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 160 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/47 (70%), Positives = 35/47 (74%) Frame = -1 Query: 255 DLLSMAGGFFRIKQDWGGQGRRIGTRGDAYASSLSI*FPSFPVSGSG 115 DL SMAG F + WGGQGR IG+RGDAYASSLSI FPSF V G G Sbjct: 71 DLFSMAGAFVS-RVCWGGQGRWIGSRGDAYASSLSIGFPSFSVYGEG 116 >ref|XP_002535856.1| conserved hypothetical protein [Ricinus communis] gi|223521723|gb|EEF26527.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 210 WGGQGRRIGTRGDAYASSLSI*FPSFPVSGSG 115 WGGQGRRIG+RGDAYASSLSI FPSF V G G Sbjct: 15 WGGQGRRIGSRGDAYASSLSIEFPSFAVYGEG 46