BLASTX nr result
ID: Rauwolfia21_contig00024813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00024813 (310 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ01234.1| hypothetical protein PRUPE_ppa024199mg [Prunus pe... 43 1e-06 >gb|EMJ01234.1| hypothetical protein PRUPE_ppa024199mg [Prunus persica] Length = 255 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -2 Query: 135 KDAQALLHIQRGLSKFVFPRIVGAIKSKEAWD 40 KDA+AL +Q+ L +FPRI+GA SKEAWD Sbjct: 51 KDAKALFALQQALDDTIFPRIMGATTSKEAWD 82 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 278 ENYEFWSKQMKKHFISQDF*ELITEECEEP 189 ENY+FWS +MK +F+SQD +++ P Sbjct: 17 ENYDFWSIKMKSYFMSQDLWDIVDSGFNNP 46