BLASTX nr result
ID: Rauwolfia21_contig00024412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00024412 (301 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368659.1| hypothetical protein POPTR_0001s07450g, part... 60 3e-07 >ref|XP_006368659.1| hypothetical protein POPTR_0001s07450g, partial [Populus trichocarpa] gi|550346740|gb|ERP65228.1| hypothetical protein POPTR_0001s07450g, partial [Populus trichocarpa] Length = 142 Score = 60.1 bits (144), Expect = 3e-07 Identities = 36/74 (48%), Positives = 49/74 (66%), Gaps = 10/74 (13%) Frame = -2 Query: 192 EGEEKRTVLAGLRVLLSRLGG--NRKRKVRIKMIE--------WRQKMVFPIRRVWVAVS 43 E E++ LAGL+ + R+ G +R+RK R K I+ W KM+FP+RRVW++VS Sbjct: 21 EEEKESEGLAGLKSIAVRVVGGFSRRRKARTKKIKVEDKLMDLWH-KMIFPVRRVWLSVS 79 Query: 42 SRVKARKNGQSLYS 1 +RVKARKNG SL S Sbjct: 80 ARVKARKNGPSLLS 93