BLASTX nr result
ID: Rauwolfia21_contig00022842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00022842 (295 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520847.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 gb|EXB96513.1| Reticulon-like protein [Morus notabilis] 57 2e-06 ref|XP_002325809.2| hypothetical protein POPTR_0019s07520g [Popu... 57 3e-06 ref|XP_006435881.1| hypothetical protein CICLE_v10031264mg [Citr... 56 4e-06 ref|XP_006604077.1| PREDICTED: uncharacterized protein LOC100802... 56 6e-06 ref|XP_006604076.1| PREDICTED: uncharacterized protein LOC100802... 56 6e-06 ref|XP_002530228.1| hypothetical protein RCOM_1665550 [Ricinus c... 56 6e-06 ref|XP_004165425.1| PREDICTED: uncharacterized protein LOC101229... 55 7e-06 ref|XP_004146447.1| PREDICTED: uncharacterized protein LOC101212... 55 7e-06 ref|XP_002534568.1| hypothetical protein RCOM_0451290 [Ricinus c... 55 7e-06 ref|XP_006843735.1| hypothetical protein AMTR_s00007p00225240 [A... 55 1e-05 ref|XP_002279449.1| PREDICTED: uncharacterized protein LOC100258... 55 1e-05 emb|CBI25383.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|XP_002520847.1| conserved hypothetical protein [Ricinus communis] gi|223539978|gb|EEF41556.1| conserved hypothetical protein [Ricinus communis] Length = 364 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +C +VVTYVVTRPGRELLFTVVSQEEKYKAK Sbjct: 267 ICETLRKVVTYVVTRPGRELLFTVVSQEEKYKAK 300 >gb|EXB96513.1| Reticulon-like protein [Morus notabilis] Length = 545 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 VC +VVTYVVTRPGRELLFTVVSQ+EKYKAK Sbjct: 484 VCETLRKVVTYVVTRPGRELLFTVVSQDEKYKAK 517 >ref|XP_002325809.2| hypothetical protein POPTR_0019s07520g [Populus trichocarpa] gi|550316950|gb|EEF00191.2| hypothetical protein POPTR_0019s07520g [Populus trichocarpa] Length = 517 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +C +VVTYVVTRPGRELLFTVV+QEEKYKAK Sbjct: 420 ICETVRKVVTYVVTRPGRELLFTVVTQEEKYKAK 453 >ref|XP_006435881.1| hypothetical protein CICLE_v10031264mg [Citrus clementina] gi|568865680|ref|XP_006486200.1| PREDICTED: uncharacterized protein LOC102622187 [Citrus sinensis] gi|557538077|gb|ESR49121.1| hypothetical protein CICLE_v10031264mg [Citrus clementina] Length = 513 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 212 QVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +VVTYVVTRPGRELLFTVVSQEEKYKAK Sbjct: 419 KVVTYVVTRPGRELLFTVVSQEEKYKAK 446 >ref|XP_006604077.1| PREDICTED: uncharacterized protein LOC100802404 isoform X2 [Glycine max] Length = 453 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +C +VVTYVVTRPGRELLFTVVS++EKYKAK Sbjct: 354 ICETLRKVVTYVVTRPGRELLFTVVSEDEKYKAK 387 >ref|XP_006604076.1| PREDICTED: uncharacterized protein LOC100802404 isoform X1 [Glycine max] Length = 500 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +C +VVTYVVTRPGRELLFTVVS++EKYKAK Sbjct: 401 ICETLRKVVTYVVTRPGRELLFTVVSEDEKYKAK 434 >ref|XP_002530228.1| hypothetical protein RCOM_1665550 [Ricinus communis] gi|223530254|gb|EEF32155.1| hypothetical protein RCOM_1665550 [Ricinus communis] Length = 145 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +C +V+TYVVTRPGRELLFTVVSQE+KYKAK Sbjct: 70 ICEALRKVLTYVVTRPGRELLFTVVSQEDKYKAK 103 >ref|XP_004165425.1| PREDICTED: uncharacterized protein LOC101229022 [Cucumis sativus] Length = 490 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 VC +V TYVVTRPGRELLFTVVSQ+EKYKAK Sbjct: 390 VCETVRKVTTYVVTRPGRELLFTVVSQDEKYKAK 423 >ref|XP_004146447.1| PREDICTED: uncharacterized protein LOC101212005 [Cucumis sativus] Length = 490 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 VC +V TYVVTRPGRELLFTVVSQ+EKYKAK Sbjct: 390 VCETVRKVTTYVVTRPGRELLFTVVSQDEKYKAK 423 >ref|XP_002534568.1| hypothetical protein RCOM_0451290 [Ricinus communis] gi|223525011|gb|EEF27814.1| hypothetical protein RCOM_0451290 [Ricinus communis] Length = 160 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 194 VCFLFFQVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +C +V+TYVVTRPGRELLFTVVSQE+KYKAK Sbjct: 70 ICEALRKVLTYVVTRPGRELLFTVVSQEKKYKAK 103 >ref|XP_006843735.1| hypothetical protein AMTR_s00007p00225240 [Amborella trichopoda] gi|548846103|gb|ERN05410.1| hypothetical protein AMTR_s00007p00225240 [Amborella trichopoda] Length = 495 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +2 Query: 212 QVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +VVTYVVTRPGRELLFTVVSQ+EKYKAK Sbjct: 401 KVVTYVVTRPGRELLFTVVSQDEKYKAK 428 >ref|XP_002279449.1| PREDICTED: uncharacterized protein LOC100258787 [Vitis vinifera] Length = 492 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +2 Query: 212 QVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +VVTYVVTRPGRELLFTVVSQ+EKYKAK Sbjct: 398 KVVTYVVTRPGRELLFTVVSQDEKYKAK 425 >emb|CBI25383.3| unnamed protein product [Vitis vinifera] Length = 503 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +2 Query: 212 QVVTYVVTRPGRELLFTVVSQEEKYKAK 295 +VVTYVVTRPGRELLFTVVSQ+EKYKAK Sbjct: 409 KVVTYVVTRPGRELLFTVVSQDEKYKAK 436