BLASTX nr result
ID: Rauwolfia21_contig00022096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00022096 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY21946.1| Kinase superfamily protein [Theobroma cacao] 59 5e-07 gb|EMJ12085.1| hypothetical protein PRUPE_ppa002234mg [Prunus pe... 57 2e-06 >gb|EOY21946.1| Kinase superfamily protein [Theobroma cacao] Length = 716 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/39 (76%), Positives = 33/39 (84%), Gaps = 5/39 (12%) Frame = -1 Query: 102 MGCVTSKQAVTVTPAFDHSGALRDNAGIG-----SGRSR 1 MGCV+SKQAV+VTPAFDHSGALR+NAG G SGRSR Sbjct: 1 MGCVSSKQAVSVTPAFDHSGALRENAGAGSVGTNSGRSR 39 >gb|EMJ12085.1| hypothetical protein PRUPE_ppa002234mg [Prunus persica] Length = 698 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 102 MGCVTSKQAVTVTPAFDHSGALRDNAGIGSGRSR 1 MGCV+SKQAV+VTPAFDHSGA RDN G SGRSR Sbjct: 1 MGCVSSKQAVSVTPAFDHSGAFRDNVG-NSGRSR 33