BLASTX nr result
ID: Rauwolfia21_contig00019940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00019940 (517 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513917.1| Ribosome-binding protein, putative [Ricinus ... 91 2e-16 ref|XP_006364852.1| PREDICTED: synaptonemal complex protein 1-li... 89 5e-16 gb|EOY16005.1| Myosin heavy chain-related protein [Theobroma cacao] 88 1e-15 ref|XP_004238527.1| PREDICTED: synaptonemal complex protein 1-li... 88 1e-15 ref|XP_003634472.1| PREDICTED: synaptonemal complex protein 2-li... 86 4e-15 emb|CBI19158.3| unnamed protein product [Vitis vinifera] 86 4e-15 gb|EMJ25263.1| hypothetical protein PRUPE_ppa015312mg [Prunus pe... 86 5e-15 ref|XP_004301922.1| PREDICTED: synaptonemal complex protein 1-li... 85 9e-15 ref|XP_004163196.1| PREDICTED: LOW QUALITY PROTEIN: synaptonemal... 79 8e-13 ref|XP_004136213.1| PREDICTED: synaptonemal complex protein 1-li... 79 8e-13 ref|XP_006472610.1| PREDICTED: synaptonemal complex protein 1-li... 74 2e-11 ref|XP_006472608.1| PREDICTED: synaptonemal complex protein 1-li... 74 2e-11 ref|XP_006433993.1| hypothetical protein CICLE_v10000237mg [Citr... 74 2e-11 ref|XP_004490374.1| PREDICTED: LOW QUALITY PROTEIN: synaptonemal... 74 2e-11 ref|XP_002890507.1| hypothetical protein ARALYDRAFT_889731 [Arab... 74 2e-11 ref|XP_003615101.1| Synaptonemal complex protein [Medicago trunc... 74 3e-11 gb|ESW13170.1| hypothetical protein PHAVU_008G173500g [Phaseolus... 72 8e-11 gb|ESW13168.1| hypothetical protein PHAVU_008G173500g [Phaseolus... 72 8e-11 gb|EPS72663.1| hypothetical protein M569_02095, partial [Genlise... 72 1e-10 ref|XP_002302294.2| hypothetical protein POPTR_0002s09680g [Popu... 71 1e-10 >ref|XP_002513917.1| Ribosome-binding protein, putative [Ricinus communis] gi|223547003|gb|EEF48500.1| Ribosome-binding protein, putative [Ricinus communis] Length = 868 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/58 (75%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETK-RGQPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF DPRKH K TP +ITPR + K TK RG+ PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 811 VMFEDPRKHKKKNTPKSITPRSVAKGTKIRGRSHPSNIGDLFSEGSLNPYADDPYAFD 868 >ref|XP_006364852.1| PREDICTED: synaptonemal complex protein 1-like [Solanum tuberosum] Length = 868 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/57 (70%), Positives = 44/57 (77%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRGQPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF DP KH K TP TP+ I+ K+G PKP+NIGDLFSEGSLNPYADDPYAFD Sbjct: 812 VMFDDPSKHKKRRTPKVKTPKEIIGVVKKGHPKPANIGDLFSEGSLNPYADDPYAFD 868 >gb|EOY16005.1| Myosin heavy chain-related protein [Theobroma cacao] Length = 875 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/57 (73%), Positives = 43/57 (75%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRGQPKPSNIGDLFSEGSLNPYADDPYAFD 345 V+F DPRKH K TP TPR VK TK PK SNIGDLFSEGSLNPYADDPYAFD Sbjct: 819 VLFEDPRKHKKVRTPKANTPRSFVKGTKGSHPKASNIGDLFSEGSLNPYADDPYAFD 875 >ref|XP_004238527.1| PREDICTED: synaptonemal complex protein 1-like [Solanum lycopersicum] Length = 868 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/57 (70%), Positives = 44/57 (77%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRGQPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF DP KH K TP TP+ I+ +GQPKP+NIGDLFSEGSLNPYADDPYAFD Sbjct: 812 VMFDDPSKHKKRRTPKVKTPKEIIGVVIKGQPKPANIGDLFSEGSLNPYADDPYAFD 868 >ref|XP_003634472.1| PREDICTED: synaptonemal complex protein 2-like [Vitis vinifera] Length = 868 Score = 86.3 bits (212), Expect = 4e-15 Identities = 43/58 (74%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRGQP-KPSNIGDLFSEGSLNPYADDPYAFD 345 VMFGDPRKH K TP TPR IVKE K + PSNIG+LFSEGSLNPYADDPYAFD Sbjct: 811 VMFGDPRKHKKANTPKAHTPRTIVKEIKGDRHLHPSNIGELFSEGSLNPYADDPYAFD 868 >emb|CBI19158.3| unnamed protein product [Vitis vinifera] Length = 876 Score = 86.3 bits (212), Expect = 4e-15 Identities = 43/58 (74%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRGQP-KPSNIGDLFSEGSLNPYADDPYAFD 345 VMFGDPRKH K TP TPR IVKE K + PSNIG+LFSEGSLNPYADDPYAFD Sbjct: 819 VMFGDPRKHKKANTPKAHTPRTIVKEIKGDRHLHPSNIGELFSEGSLNPYADDPYAFD 876 >gb|EMJ25263.1| hypothetical protein PRUPE_ppa015312mg [Prunus persica] Length = 863 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/54 (75%), Positives = 43/54 (79%), Gaps = 1/54 (1%) Frame = -3 Query: 503 DPRKHNKGETPVTITPRHIVKETKRG-QPKPSNIGDLFSEGSLNPYADDPYAFD 345 DPRKH K TP TPR +VK +K G QP PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 810 DPRKHKKTSTPKATTPRSVVKGSKGGGQPNPSNIGDLFSEGSLNPYADDPYAFD 863 >ref|XP_004301922.1| PREDICTED: synaptonemal complex protein 1-like [Fragaria vesca subsp. vesca] Length = 766 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/58 (70%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETK-RGQPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF DPRKH + TP +PR +VK +K GQP+ SNIGDLFSEGSLNPYADDPYAFD Sbjct: 709 VMFEDPRKHKRTTTPKVKSPRGVVKGSKGEGQPRASNIGDLFSEGSLNPYADDPYAFD 766 >ref|XP_004163196.1| PREDICTED: LOW QUALITY PROTEIN: synaptonemal complex protein 1-like [Cucumis sativus] Length = 869 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/59 (71%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPR-HIVKETKRG-QPKPSNIGDLFSEGSLNPYADDPYAFD 345 V+F DPRKHNK TP TPR +VK+ K G + +PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 813 VLFEDPRKHNK--TPRRNTPRGSVVKKIKGGGESRPSNIGDLFSEGSLNPYADDPYAFD 869 >ref|XP_004136213.1| PREDICTED: synaptonemal complex protein 1-like [Cucumis sativus] Length = 869 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/59 (71%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPR-HIVKETKRG-QPKPSNIGDLFSEGSLNPYADDPYAFD 345 V+F DPRKHNK TP TPR +VK+ K G + +PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 813 VLFEDPRKHNK--TPRRNTPRGSVVKKIKGGGESRPSNIGDLFSEGSLNPYADDPYAFD 869 >ref|XP_006472610.1| PREDICTED: synaptonemal complex protein 1-like isoform X3 [Citrus sinensis] Length = 761 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRG-QPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF DP K K T TPR + K G P PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 704 VMFEDPGKRKKMNTTQAKTPRSVAKGAMGGANPHPSNIGDLFSEGSLNPYADDPYAFD 761 >ref|XP_006472608.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Citrus sinensis] gi|568837184|ref|XP_006472609.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Citrus sinensis] Length = 872 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRG-QPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF DP K K T TPR + K G P PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 815 VMFEDPGKRKKMNTTQAKTPRSVAKGAMGGANPHPSNIGDLFSEGSLNPYADDPYAFD 872 >ref|XP_006433993.1| hypothetical protein CICLE_v10000237mg [Citrus clementina] gi|557536115|gb|ESR47233.1| hypothetical protein CICLE_v10000237mg [Citrus clementina] Length = 872 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRG-QPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF DP K K T TPR + K G P PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 815 VMFEDPGKRKKMNTTQAKTPRSVAKGATGGANPHPSNIGDLFSEGSLNPYADDPYAFD 872 >ref|XP_004490374.1| PREDICTED: LOW QUALITY PROTEIN: synaptonemal complex protein 1-like [Cicer arietinum] Length = 988 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/56 (67%), Positives = 41/56 (73%) Frame = -3 Query: 512 MFGDPRKHNKGETPVTITPRHIVKETKRGQPKPSNIGDLFSEGSLNPYADDPYAFD 345 +F DPRK K TP T TPR +VK + PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 934 LFQDPRKQ-KINTPKTNTPRTVVKSMRVDGHPPSNIGDLFSEGSLNPYADDPYAFD 988 >ref|XP_002890507.1| hypothetical protein ARALYDRAFT_889731 [Arabidopsis lyrata subsp. lyrata] gi|297336349|gb|EFH66766.1| hypothetical protein ARALYDRAFT_889731 [Arabidopsis lyrata subsp. lyrata] Length = 871 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 512 MFGDPRKHNKGETPVTITPRHIVKETKR-GQPKPSNIGDLFSEGSLNPYADDPYAFD 345 MF +P++ + TP +TP+ I KET G P+ +NIGDLFSEGSLNPYADDPYAFD Sbjct: 815 MFQEPQRRSTRLTPKLMTPKSIAKETSMAGHPRSANIGDLFSEGSLNPYADDPYAFD 871 >ref|XP_003615101.1| Synaptonemal complex protein [Medicago truncatula] gi|355516436|gb|AES98059.1| Synaptonemal complex protein [Medicago truncatula] Length = 999 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/57 (66%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 512 MFGDPRKHNKGETPVTITPRHIVKETK-RGQPKPSNIGDLFSEGSLNPYADDPYAFD 345 ++ DPRK K TP T TPR VK + P+PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 944 VYQDPRKQ-KINTPKTNTPRTFVKSQRVEDHPRPSNIGDLFSEGSLNPYADDPYAFD 999 >gb|ESW13170.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris] Length = 867 Score = 72.0 bits (175), Expect = 8e-11 Identities = 39/58 (67%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKR-GQPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF D R + K TP TPR +VK K G PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 811 VMFEDSR-NRKINTPKVNTPRSVVKSIKGVGHTNPSNIGDLFSEGSLNPYADDPYAFD 867 >gb|ESW13168.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris] Length = 868 Score = 72.0 bits (175), Expect = 8e-11 Identities = 39/58 (67%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKR-GQPKPSNIGDLFSEGSLNPYADDPYAFD 345 VMF D R + K TP TPR +VK K G PSNIGDLFSEGSLNPYADDPYAFD Sbjct: 812 VMFEDSR-NRKINTPKVNTPRSVVKSIKGVGHTNPSNIGDLFSEGSLNPYADDPYAFD 868 >gb|EPS72663.1| hypothetical protein M569_02095, partial [Genlisea aurea] Length = 340 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 3/57 (5%) Frame = -3 Query: 515 VMFGDPRKHNKGETPVTITPRHIVKETKRG--QPKPSNIGDLFSEGSLNPYAD-DPY 354 VMFGDPRKH TP TP+ +V+ +G PKPSNIGDLF+EGSLNPYAD DP+ Sbjct: 284 VMFGDPRKHRSRCTPKIRTPKEMVQSVVKGGVHPKPSNIGDLFTEGSLNPYADVDPF 340 >ref|XP_002302294.2| hypothetical protein POPTR_0002s09680g [Populus trichocarpa] gi|550344656|gb|EEE81567.2| hypothetical protein POPTR_0002s09680g [Populus trichocarpa] Length = 874 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/59 (64%), Positives = 40/59 (67%), Gaps = 3/59 (5%) Frame = -3 Query: 515 VMFGDPRKHNKGET--PVTITPRHIVKETKRG-QPKPSNIGDLFSEGSLNPYADDPYAF 348 VMF DPRKH + T P TPR + K K G Q PS IGDLF EGSLNPYADDPYAF Sbjct: 815 VMFEDPRKHERTRTNTPKARTPRSVAKGLKGGDQSHPSTIGDLFLEGSLNPYADDPYAF 873