BLASTX nr result
ID: Rauwolfia21_contig00019867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00019867 (1892 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239653.1| PREDICTED: aspartate--tRNA ligase, cytoplasm... 60 3e-06 gb|EXB60460.1| Aspartate--tRNA ligase [Morus notabilis] 60 3e-06 ref|XP_006422161.1| hypothetical protein CICLE_v10004669mg [Citr... 60 4e-06 ref|XP_006345989.1| PREDICTED: aspartate--tRNA ligase, cytoplasm... 59 6e-06 ref|XP_002308157.2| aspartyl-tRNA synthetase family protein [Pop... 59 7e-06 gb|EOY29091.1| Class II aminoacyl-tRNA and biotin synthetases su... 59 7e-06 gb|EOY29090.1| Class II aminoacyl-tRNA and biotin synthetases su... 59 7e-06 gb|EOY29089.1| Class II aminoacyl-tRNA and biotin synthetases su... 59 7e-06 ref|XP_006290941.1| hypothetical protein CARUB_v10017054mg [Caps... 59 7e-06 gb|AAL61938.1| aspartate--tRNA ligase - like protein [Arabidopsi... 59 7e-06 ref|XP_002869341.1| hypothetical protein ARALYDRAFT_491623 [Arab... 59 7e-06 ref|NP_849558.1| Asx tRNA synthetase (AspRS/AsnRS) class II core... 59 7e-06 ref|XP_004162485.1| PREDICTED: aspartate--tRNA ligase, cytoplasm... 59 1e-05 ref|XP_004136326.1| PREDICTED: aspartate--tRNA ligase, cytoplasm... 59 1e-05 ref|XP_002876233.1| predicted protein [Arabidopsis lyrata subsp.... 59 1e-05 >ref|XP_004239653.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Solanum lycopersicum] Length = 544 Score = 60.5 bits (145), Expect = 3e-06 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L+EAGVEVDPLGDLNTESERKLGQLV EKYG Sbjct: 398 LKEAGVEVDPLGDLNTESERKLGQLVAEKYG 428 >gb|EXB60460.1| Aspartate--tRNA ligase [Morus notabilis] Length = 541 Score = 60.1 bits (144), Expect = 3e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L++AGVEVDPLGDLNTESERKLGQLV EKYG Sbjct: 395 LKDAGVEVDPLGDLNTESERKLGQLVLEKYG 425 >ref|XP_006422161.1| hypothetical protein CICLE_v10004669mg [Citrus clementina] gi|568874858|ref|XP_006490529.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Citrus sinensis] gi|557524034|gb|ESR35401.1| hypothetical protein CICLE_v10004669mg [Citrus clementina] Length = 553 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L++AGVE+DPLGDLNTESERKLGQLV EKYG Sbjct: 407 LKDAGVEIDPLGDLNTESERKLGQLVLEKYG 437 >ref|XP_006345989.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Solanum tuberosum] Length = 539 Score = 59.3 bits (142), Expect = 6e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L+EAGVEVDPLGDLNTESERKLGQLV +KYG Sbjct: 393 LKEAGVEVDPLGDLNTESERKLGQLVADKYG 423 >ref|XP_002308157.2| aspartyl-tRNA synthetase family protein [Populus trichocarpa] gi|550335791|gb|EEE91680.2| aspartyl-tRNA synthetase family protein [Populus trichocarpa] Length = 545 Score = 58.9 bits (141), Expect = 7e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L+EAGVE+DP GDLNTESERKLGQLV EKYG Sbjct: 399 LKEAGVEIDPYGDLNTESERKLGQLVLEKYG 429 >gb|EOY29091.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein isoform 3 [Theobroma cacao] Length = 506 Score = 58.9 bits (141), Expect = 7e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L++AGVEVDPLGDLNTE+ERKLGQLV EKYG Sbjct: 360 LKDAGVEVDPLGDLNTEAERKLGQLVLEKYG 390 >gb|EOY29090.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein isoform 2 [Theobroma cacao] Length = 526 Score = 58.9 bits (141), Expect = 7e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L++AGVEVDPLGDLNTE+ERKLGQLV EKYG Sbjct: 397 LKDAGVEVDPLGDLNTEAERKLGQLVLEKYG 427 >gb|EOY29089.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein isoform 1 [Theobroma cacao] Length = 543 Score = 58.9 bits (141), Expect = 7e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L++AGVEVDPLGDLNTE+ERKLGQLV EKYG Sbjct: 397 LKDAGVEVDPLGDLNTEAERKLGQLVLEKYG 427 >ref|XP_006290941.1| hypothetical protein CARUB_v10017054mg [Capsella rubella] gi|482559648|gb|EOA23839.1| hypothetical protein CARUB_v10017054mg [Capsella rubella] Length = 506 Score = 58.9 bits (141), Expect = 7e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKY 1888 L+EAGVEVDPLGDLNTESERKLGQLV EKY Sbjct: 360 LKEAGVEVDPLGDLNTESERKLGQLVLEKY 389 >gb|AAL61938.1| aspartate--tRNA ligase - like protein [Arabidopsis thaliana] gi|27311923|gb|AAO00927.1| aspartate--tRNA ligase - like protein [Arabidopsis thaliana] Length = 405 Score = 58.9 bits (141), Expect = 7e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKY 1888 L+EAGVEVDPLGDLNTESERKLGQLV EKY Sbjct: 259 LKEAGVEVDPLGDLNTESERKLGQLVLEKY 288 >ref|XP_002869341.1| hypothetical protein ARALYDRAFT_491623 [Arabidopsis lyrata subsp. lyrata] gi|297315177|gb|EFH45600.1| hypothetical protein ARALYDRAFT_491623 [Arabidopsis lyrata subsp. lyrata] Length = 557 Score = 58.9 bits (141), Expect = 7e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKY 1888 L+EAGVEVDPLGDLNTESERKLGQLV EKY Sbjct: 411 LKEAGVEVDPLGDLNTESERKLGQLVLEKY 440 >ref|NP_849558.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating protein [Arabidopsis thaliana] gi|30688949|ref|NP_194847.3| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating protein [Arabidopsis thaliana] gi|7270020|emb|CAB79836.1| aspartate--tRNA ligase-like protein [Arabidopsis thaliana] gi|222424631|dbj|BAH20270.1| AT4G31180 [Arabidopsis thaliana] gi|332660472|gb|AEE85872.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating protein [Arabidopsis thaliana] gi|332660473|gb|AEE85873.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating protein [Arabidopsis thaliana] Length = 558 Score = 58.9 bits (141), Expect = 7e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKY 1888 L+EAGVEVDPLGDLNTESERKLGQLV EKY Sbjct: 412 LKEAGVEVDPLGDLNTESERKLGQLVLEKY 441 >ref|XP_004162485.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cucumis sativus] Length = 545 Score = 58.5 bits (140), Expect = 1e-05 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L++AGVE+DPLGDLNTE+ERKLGQLV EKYG Sbjct: 399 LKDAGVEIDPLGDLNTEAERKLGQLVLEKYG 429 >ref|XP_004136326.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cucumis sativus] Length = 545 Score = 58.5 bits (140), Expect = 1e-05 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKYG 1891 L++AGVE+DPLGDLNTE+ERKLGQLV EKYG Sbjct: 399 LKDAGVEIDPLGDLNTEAERKLGQLVLEKYG 429 >ref|XP_002876233.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322071|gb|EFH52492.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 550 Score = 58.5 bits (140), Expect = 1e-05 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 1799 LQEAGVEVDPLGDLNTESERKLGQLVFEKY 1888 L+EAGVE+DPLGDLNTESERKLGQLV EKY Sbjct: 404 LKEAGVEIDPLGDLNTESERKLGQLVLEKY 433