BLASTX nr result
ID: Rauwolfia21_contig00019820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00019820 (1725 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604991.1| Sterol 3-beta-glucosyltransferase [Medicago ... 59 6e-06 >ref|XP_003604991.1| Sterol 3-beta-glucosyltransferase [Medicago truncatula] gi|355506046|gb|AES87188.1| Sterol 3-beta-glucosyltransferase [Medicago truncatula] Length = 623 Score = 58.9 bits (141), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 980 LQSVTEPKDSIYLLDNVPHDWLFLQCAAVV 891 L +TEPKDSIYLLDNVPHDWLFLQC AVV Sbjct: 473 LGDLTEPKDSIYLLDNVPHDWLFLQCKAVV 502