BLASTX nr result
ID: Rauwolfia21_contig00017842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00017842 (242 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494111.1| PREDICTED: uncharacterized protein LOC102617... 81 1e-13 ref|XP_006432885.1| hypothetical protein CICLE_v10002031mg [Citr... 81 1e-13 ref|XP_006432884.1| hypothetical protein CICLE_v10002031mg [Citr... 81 1e-13 gb|AFK37486.1| unknown [Lotus japonicus] 81 1e-13 ref|XP_006604860.1| PREDICTED: uncharacterized protein LOC100811... 80 2e-13 ref|XP_003554718.1| PREDICTED: uncharacterized protein LOC100811... 80 2e-13 ref|NP_001241122.1| uncharacterized protein LOC100802211 [Glycin... 80 2e-13 ref|XP_002273920.2| PREDICTED: protein notum homolog [Vitis vini... 80 3e-13 emb|CBI29218.3| unnamed protein product [Vitis vinifera] 80 4e-13 ref|XP_004300395.1| PREDICTED: uncharacterized protein LOC101305... 79 5e-13 ref|XP_004300393.1| PREDICTED: uncharacterized protein LOC101305... 79 5e-13 ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sa... 79 5e-13 gb|ESW19196.1| hypothetical protein PHAVU_006G104200g [Phaseolus... 79 8e-13 gb|EOY25400.1| Profilin family protein [Theobroma cacao] 78 1e-12 ref|XP_004494845.1| PREDICTED: uncharacterized protein LOC101490... 77 2e-12 gb|EMJ10825.1| hypothetical protein PRUPE_ppa011789mg [Prunus pe... 77 2e-12 ref|XP_004497936.1| PREDICTED: uncharacterized protein LOC101500... 76 5e-12 ref|XP_002517221.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 gb|AFK46033.1| unknown [Medicago truncatula] 71 2e-10 ref|XP_002867941.1| hypothetical protein ARALYDRAFT_354810 [Arab... 70 2e-10 >ref|XP_006494111.1| PREDICTED: uncharacterized protein LOC102617174 isoform X1 [Citrus sinensis] gi|568882609|ref|XP_006494112.1| PREDICTED: uncharacterized protein LOC102617174 isoform X2 [Citrus sinensis] gi|568882611|ref|XP_006494113.1| PREDICTED: uncharacterized protein LOC102617174 isoform X3 [Citrus sinensis] gi|568882613|ref|XP_006494114.1| PREDICTED: uncharacterized protein LOC102617174 isoform X4 [Citrus sinensis] gi|568882615|ref|XP_006494115.1| PREDICTED: uncharacterized protein LOC102617174 isoform X5 [Citrus sinensis] gi|568882617|ref|XP_006494116.1| PREDICTED: uncharacterized protein LOC102617174 isoform X6 [Citrus sinensis] Length = 147 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW+FV+K W+KWAS++VGS G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDWSFVHKTWEKWASTSVGSSGEPLKAALLINYDPTGPSRLLST 44 >ref|XP_006432885.1| hypothetical protein CICLE_v10002031mg [Citrus clementina] gi|567880655|ref|XP_006432886.1| hypothetical protein CICLE_v10002031mg [Citrus clementina] gi|557535007|gb|ESR46125.1| hypothetical protein CICLE_v10002031mg [Citrus clementina] gi|557535008|gb|ESR46126.1| hypothetical protein CICLE_v10002031mg [Citrus clementina] Length = 294 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW+FV+K W+KWAS++VGS G PLK+ALLINYDPTGPSRLLST Sbjct: 148 MDWSFVHKTWEKWASTSVGSSGEPLKAALLINYDPTGPSRLLST 191 >ref|XP_006432884.1| hypothetical protein CICLE_v10002031mg [Citrus clementina] gi|557535006|gb|ESR46124.1| hypothetical protein CICLE_v10002031mg [Citrus clementina] Length = 274 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW+FV+K W+KWAS++VGS G PLK+ALLINYDPTGPSRLLST Sbjct: 148 MDWSFVHKTWEKWASTSVGSSGEPLKAALLINYDPTGPSRLLST 191 >gb|AFK37486.1| unknown [Lotus japonicus] Length = 147 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV+K WDKWAS+N+G G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDWGFVHKTWDKWASTNIGYSGYPLKAALLINYDPTGPSRLLST 44 >ref|XP_006604860.1| PREDICTED: uncharacterized protein LOC100811973 isoform X2 [Glycine max] Length = 140 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV+K WDKWAS+N+G G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDWAFVHKTWDKWASTNIGYSGHPLKAALLINYDPTGPSRLLST 44 >ref|XP_003554718.1| PREDICTED: uncharacterized protein LOC100811973 isoform X1 [Glycine max] Length = 147 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV+K WDKWAS+N+G G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDWAFVHKTWDKWASTNIGYSGHPLKAALLINYDPTGPSRLLST 44 >ref|NP_001241122.1| uncharacterized protein LOC100802211 [Glycine max] gi|255646679|gb|ACU23813.1| unknown [Glycine max] Length = 147 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV+K WDKWAS+N+G G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDWAFVHKTWDKWASTNIGYSGHPLKAALLINYDPTGPSRLLST 44 >ref|XP_002273920.2| PREDICTED: protein notum homolog [Vitis vinifera] Length = 521 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 140 QDMDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 Q MDW FV K WDKW S+++GS G PLK+ALLINYDPTGPSRLLST Sbjct: 373 QLMDWTFVRKAWDKWISTSIGSSGEPLKAALLINYDPTGPSRLLST 418 >emb|CBI29218.3| unnamed protein product [Vitis vinifera] Length = 147 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV K WDKW S+++GS G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDWTFVRKAWDKWISTSIGSSGEPLKAALLINYDPTGPSRLLST 44 >ref|XP_004300395.1| PREDICTED: uncharacterized protein LOC101305474 isoform 3 [Fragaria vesca subsp. vesca] Length = 127 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW F++K+W+KWAS +VGS G PLK+A+L+NYDPTGPSRLLST Sbjct: 1 MDWGFIHKVWEKWASLSVGSSGRPLKAAILLNYDPTGPSRLLST 44 >ref|XP_004300393.1| PREDICTED: uncharacterized protein LOC101305474 isoform 1 [Fragaria vesca subsp. vesca] gi|470128948|ref|XP_004300394.1| PREDICTED: uncharacterized protein LOC101305474 isoform 2 [Fragaria vesca subsp. vesca] Length = 147 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW F++K+W+KWAS +VGS G PLK+A+L+NYDPTGPSRLLST Sbjct: 1 MDWGFIHKVWEKWASLSVGSSGRPLKAAILLNYDPTGPSRLLST 44 >ref|XP_004150551.1| PREDICTED: protein notum homolog [Cucumis sativus] Length = 539 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 137 DMDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 +MDW FV+K WDKWAS ++G+ G PLK+ALLINYDPTGPSRLLST Sbjct: 392 EMDWAFVHKAWDKWASGSIGTFGQPLKAALLINYDPTGPSRLLST 436 >gb|ESW19196.1| hypothetical protein PHAVU_006G104200g [Phaseolus vulgaris] Length = 147 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV+K WDKWAS+N+G G PLK+ALLIN+DPTGPSRLLST Sbjct: 1 MDWAFVHKAWDKWASTNIGYSGHPLKAALLINHDPTGPSRLLST 44 >gb|EOY25400.1| Profilin family protein [Theobroma cacao] Length = 147 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV K WDKWASSN+GS G PLK+ALLINYDP PSRLLST Sbjct: 1 MDWAFVQKSWDKWASSNIGSSGEPLKAALLINYDPLRPSRLLST 44 >ref|XP_004494845.1| PREDICTED: uncharacterized protein LOC101490580 isoform X1 [Cicer arietinum] gi|502114054|ref|XP_004494846.1| PREDICTED: uncharacterized protein LOC101490580 isoform X2 [Cicer arietinum] Length = 146 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW +V+K WDKWAS+N+GS G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDWAYVHKTWDKWASTNIGS-GHPLKAALLINYDPTGPSRLLST 43 >gb|EMJ10825.1| hypothetical protein PRUPE_ppa011789mg [Prunus persica] gi|462405362|gb|EMJ10826.1| hypothetical protein PRUPE_ppa011789mg [Prunus persica] Length = 196 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 137 DMDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 +MDW FV+K WDKWAS N+GS+ PLK+A+LINYDPTGPSRLLST Sbjct: 50 EMDWGFVHKAWDKWASPNIGSD-KPLKAAILINYDPTGPSRLLST 93 >ref|XP_004497936.1| PREDICTED: uncharacterized protein LOC101500436 [Cicer arietinum] Length = 44 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW +V+K WDKWAS+N+GS G PLK++LLINYDPTGPSRLLST Sbjct: 1 MDWAYVHKTWDKWASTNIGS-GHPLKASLLINYDPTGPSRLLST 43 >ref|XP_002517221.1| conserved hypothetical protein [Ricinus communis] gi|223543592|gb|EEF45121.1| conserved hypothetical protein [Ricinus communis] Length = 146 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MD++FV+K W+KWAS N+GS G PLK+ALLINYDPTGPSRLLST Sbjct: 1 MDFSFVHKAWEKWASLNIGS-GAPLKAALLINYDPTGPSRLLST 43 >gb|AFK46033.1| unknown [Medicago truncatula] Length = 146 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -1 Query: 134 MDWNFVNKIWDKWASSNVGSEGTPLKSALLINYDPTGPSRLLST 3 MDW FV+K WDKWAS+N+G PLK+ALL+N+DPT PSRLLST Sbjct: 1 MDWGFVHKTWDKWASTNIGPR-LPLKAALLVNFDPTAPSRLLST 43 >ref|XP_002867941.1| hypothetical protein ARALYDRAFT_354810 [Arabidopsis lyrata subsp. lyrata] gi|297313777|gb|EFH44200.1| hypothetical protein ARALYDRAFT_354810 [Arabidopsis lyrata subsp. lyrata] Length = 148 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -1 Query: 134 MDWNFVNKIWDKWASS-NVGSEGTPLKSALLINYDPTGPSRLLST 3 MD FV++ WDKW +S NVGS G PLK+A+LINYDPTGPSRLLST Sbjct: 1 MDSAFVDRAWDKWVTSGNVGSSGNPLKAAILINYDPTGPSRLLST 45